Property Summary

NCBI Gene PubMed Count 62
PubMed Score 89.08
PubTator Score 71.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
malignant mesothelioma 3163 3.01523413339823E-6
ovarian cancer 8492 1.64440944998564E-4
osteosarcoma 7933 0.00113248684333876
Multiple myeloma 1328 0.00131734784936004
psoriasis 6685 0.00300995489806635
Rheumatoid Arthritis 1171 0.0116136209517112
Waldenstrons macroglobulinemia 765 0.0159226930570679

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.012
Waldenstrons macroglobulinemia 1.315 0.016
Multiple myeloma 1.401 0.001
malignant mesothelioma 1.300 0.000
psoriasis -1.100 0.003
osteosarcoma 1.345 0.001
ovarian cancer -1.500 0.000

Synonym

Accession Q93034 A8K960 O14766 Q9BZC6 CUL-5
Symbols VACM1
VACM-1

Gene

PANTHER Protein Class (2)

PDB

4N9F   3DPL   3DQV   4JGH  

  Ortholog (14)

 MGI Term (1)

Gene RIF (77)

PMID Text
26253693 Studies indicate that Cullin-RING E3 ubiquitin ligases (CRL) are key players of the ubiquitylation pathway.
26241003 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25424878 These results provide important information on the assembly of the Vif-CUL5-E3 ubiquitin ligase and identify a new viV binding interface with CBF-beta at the C-terminus of HIV-1 Vif.
25408426 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25142583 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25124760 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25108430 Data indicate that cell surface adhesion molecules VCAM-1 and P-selectin play some roles in mechanical stretch-induced HL-60 cell adhesion to mouse common carotid arteries.
24810617 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
More...

AA Sequence

MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDIL      1 - 70
EFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLML     71 - 140
DTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDST    141 - 210
ERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAE    211 - 280
CQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNR    281 - 350
FSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP    351 - 420
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYV    421 - 490
NKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEE    491 - 560
FYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAEL    561 - 630
RRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMR    631 - 700
EEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDE    701 - 770
SDINTFIYMA                                                                771 - 780
//

Text Mined References (66)

PMID Year Title
26253693 2016 Cullin 5-RING E3 ubiquitin ligases, new therapeutic targets?
25424878 2014 Requirement of HIV-1 Vif C-terminus for Vif-CBF-? interaction and assembly of CUL5-containing E3 ligase.
25416956 2014 A proteome-scale map of the human interactome network.
25108430 2014 [Cell surface adhesion molecules mediated stretch-induced HL-60 cell adhesion to mouse common carotid arteries].
24760825 2014 E3 ubiquitin ligase Cullin-5 modulates multiple molecular and cellular responses to heat shock protein 90 inhibition in human cancer cells.
24422669 2014 HIV-1 Vif N-terminal motif is required for recruitment of Cul5 to suppress APOBEC3.
24402281 2014 Structural basis for hijacking CBF-? and CUL5 E3 ligase complex by HIV-1 Vif.
24390335 2014 Evolutionarily conserved requirement for core binding factor beta in the assembly of the human immunodeficiency virus/simian immunodeficiency virus Vif-cullin 5-RING E3 ubiquitin ligase.
24390320 2014 Core binding factor beta plays a critical role by facilitating the assembly of the Vif-cullin 5 E3 ubiquitin ligase.
24339204 2013 Downregulation of miR-7 upregulates Cullin 5 (CUL5) to facilitate G1/S transition in human hepatocellular carcinoma cells.
More...