Property Summary

NCBI Gene PubMed Count 65
PubMed Score 46.32
PubTator Score 37.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.200 3.5e-06
psoriasis -1.300 3.3e-04
osteosarcoma 1.254 5.7e-04
ependymoma 1.200 2.1e-07
medulloblastoma 1.800 1.1e-05
atypical teratoid / rhabdoid tumor 1.900 8.1e-08
glioblastoma 1.900 2.6e-04
medulloblastoma, large-cell 2.000 5.0e-06
primitive neuroectodermal tumor 1.200 5.1e-05
Hydrolethalus syndrome 1.232 4.8e-02
lung cancer 1.100 3.2e-02
pediatric high grade glioma 1.500 1.9e-04
spina bifida -1.654 3.8e-02
ovarian cancer -1.900 1.9e-08
Gaucher disease type 3 -1.200 2.1e-02

Gene RIF (40)

PMID Text
26617747 these results showed that knockdown of CUL4B inhibit proliferation and promotes apoptosis of colorectal cancer cells through suppressing the Wnt/beta-catenin signaling pathway
26021757 Our data are consistent with the idea that the CUL4A/B-DDB1-CRBN complex catalyses the polyubiquitination and thus controls the degradation of CLC-1 channels.
25970626 FBXO44-mediated degradation of RGS2 protein uniquely depends on a Cul4B/DDB1 complex.
25807049 HIV-1 Vpr complexes with DCAF1, DDB1, CUL4A, CUL4B, and UNG2 proteins in the cullin4 (CUL4)-containing ubiquitin ligase complex in HEK293T cells
25542213 Results show that CUL4A- and CUL4B-mediated polyubiquitination of gamma-tubulin for its degradation.
25464270 results established a critical role of CUL4B in negatively regulating the p53-ROS positive feedback loop that drives cellular senescence
25430888 CUL4B can up-regulate Wnt/beta-catenin signalling in human HCC through transcriptionally repressing Wnt antagonists and thus contributes to the malignancy of HCC.
25385192 Data show that CUL4B variants are associated with a wide range of cerebral malformations and suggest an important role in brain through its interaction with WDR62, a protein in which variants were identified in patients with cerebral malformations.
25189186 Results demonstrated that CUL4B promotes cell proliferation and inhibits the apoptosis of osteosarcoma cells.
24898194 The intellectual disability phenotype is caused by aberrant splicing and removal of intron 7 from CUL4B gene primary transcript.
24719410 HIV-1 Vpr can trigger G2 cell cycle arrest in the absence of either CUL4A or CUL4B.
24719410 HIV-1 Vpr complexes with DCAF1, DDB1, CUL4A, CUL4B, and UNG2 proteins in the cullin4 (CUL4)-containing ubiquitin ligase complex in HEK293T cells
24452595 these observations establish an important negative regulatory role of CUL4B on p53 stability.
24292684 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing
23649548 Investigated CUL4B expression pattern in patients with colon cancer; immunohistochemistry and PCR study showed that high CUL4B expression was significantly associated with colon cancer progression and pathogenesis.
23479742 the up-regulation of CDK2 by CUL4B is achieved via the repression of miR-372 and miR-373, which target CDK2.
23357576 Studies indicate Jun activation domain-binding protein Jab1 as a substrate for CUL4B E3 ligase.
23348097 Our results suggest that XLID CUL4B mutants are defective in promoting TSC2 degradation and positively regulating mTOR signaling in neocortical neurons
23238014 Cullin4B-Ring E3 ligase complex (CRL4B) is physically associated with PRC2. CRL4B possesses an intrinsic transcription repressive activity by promoting H2AK119 monoubiquitination. CUL4B promotes cancer cell proliferation, invasion, and tumorigenesis in vitro and in vivo.
22992378 The data suggest that unneddylated Cul4B isoforms specifically inhibits beta-catenin degradation during mitosis.
21816345 CUL4B targets WDR5 for ubiquitylation and degradation in the nucleus.
21795677 Cullin 4B protein ubiquitin ligase targets peroxiredoxin III for degradation.
21352845 the unexpected association of defective CUL4B with syndromal X-linked mental retardation in humans
20951943 Increased PRMT5 activity mediates key events associated with cyclin D1-dependent neoplastic growth, including CUL4 repression, CDT1 overexpression, and DNA rereplication.
20932471 This study identifies CRL4-Cdt2 ubiquitin ligase to promote the ubiquitin-dependent proteolysis of the histone H4 methyltransferase Set8 during S-phase of the cell cycle and after UV-irradiation in a reaction that is dependent on PCNA.
20064923 the interplay between CUL4A and CUL4B in pathogenesis of CUL4B-deficiency in humans
20005570 CUL4B is over-expressed in placenta in intra-uterine growth restriction.
20002452 The CUL4B gene is associated with X-linked mental retardation syndrome.
19818632 Studies indicate that CUL4 uses a large beta-propeller protein, DDB1, as a linker to interact with a subset of WD40 proteins.
19801544 Data show that that RNA interference of CUL4B led to an inhibition of cell proliferation and a prolonged S phase, due to the overaccumulation of cyclin E.
19339032 HIV-1 Vpr complexes with DCAF1, DDB1, CUL4A, CUL4B, and UNG2 proteins in the cullin4 (CUL4)-containing ubiquitin ligase complex in HEK293T cells
19295130 Cells depleted of Dda1 spontaneously accumulated double-stranded DNA breaks in a similar way to Cul4A-, Cul4B- or Wdr23-depleted cells, indicating that Dda1 interacts physically and functionally with cullin-RING E3 ligases complexes.
19056892 CUL4A and CUL4B are therefore components of a conserved Wnt-induced proteasome targeting (WIPT) complex that regulates p27(KIP1) levels and cell cycle progression in mammalian cells.
18593899 DDB1-CUL4B(DDB2) E3 ligase may have a distinctive function in modifying the chromatin structure at the site of UV lesions to promote efficient NER.
18235224 CUL4-DDB1 ubiquitin ligase interacts with Raptor and regulates the mTORC1-mediated signaling pathway through ubiquitin-dependent proteolysis.
17392787 a fat-soluble ligand-dependent ubiquitin ligase complex in human cell lines, in which dioxin receptor (AhR) is integrated as a component of a novel cullin 4B ubiquitin ligase complex, CUL4B(AhR)
17273978 Mutation in CUL4B causes X-linked mental retardation
17236139 The relatively high frequency of CUL4B mutations in this series indicates that it is one of the most commonly mutated genes underlying XLMR and suggests that its introduction into clinical diagnostics should be a high priority.
16407252 Cul4B, PCNA, and DDB1 are involved in the degradation of Cdt1 after ultraviolet radiation
16322693 human CUL4B and cyclin E proteins interact with each other and the CUL4B complexes can polyubiquitinate the CUL4B-associated cyclin E

AA Sequence

MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSS      1 - 70
NEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSS     71 - 140
SSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPE    141 - 210
NYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSL    211 - 280
DSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGI    281 - 350
LLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR    351 - 420
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVL    421 - 490
LQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPNKPA    491 - 560
ELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSML    561 - 630
SKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPE    631 - 700
MVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQA    701 - 770
TGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE    771 - 840
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYN    841 - 910
YIA                                                                       911 - 913
//

Text Mined References (79)

PMID Year Title
26617747 2015 Knockdown of CUL4B inhibits proliferation and promotes apoptosis of colorectal cancer cells through suppressing the Wnt/?-catenin signaling pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26021757 2015 The Cullin 4A/B-DDB1-Cereblon E3 Ubiquitin Ligase Complex Mediates the Degradation of CLC-1 Chloride Channels.
25970626 2015 FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex.
25542213 2015 Cullin 4A and 4B ubiquitin ligases interact with ?-tubulin and induce its polyubiquitination.
25464270 2015 CUL4B impedes stress-induced cellular senescence by dampening a p53-reactive oxygen species positive feedback loop.
25430888 2015 CUL4B activates Wnt/?-catenin signalling in hepatocellular carcinoma by repressing Wnt antagonists.
25385192 2015 Variants in CUL4B are associated with cerebral malformations.
25189186 2014 CUL4B promotes proliferation and inhibits apoptosis of human osteosarcoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24898194 2014 Donor splice-site mutation in CUL4B is likely cause of X-linked intellectual disability.
24719410 2014 Cullin4A and cullin4B are interchangeable for HIV Vpr and Vpx action through the CRL4 ubiquitin ligase complex.
24452595 2014 E3 ubiquitin ligase Cullin4B mediated polyubiquitination of p53 for its degradation.
24292684 2015 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23649548 2013 Cullin 4B is a novel prognostic marker that correlates with colon cancer progression and pathogenesis.
23479742 2013 CUL4B promotes replication licensing by up-regulating the CDK2-CDC6 cascade.
23357576 2013 X-linked intellectual disability gene CUL4B targets Jab1/CSN5 for degradation and regulates bone morphogenetic protein signaling.
23348097 2013 XLID CUL4B mutants are defective in promoting TSC2 degradation and positively regulating mTOR signaling in neocortical neurons.
23238014 2012 CRL4B catalyzes H2AK119 monoubiquitination and coordinates with PRC2 to promote tumorigenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22992378 2012 Cul4B regulates neural progenitor cell growth.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22334663 2012 Monoubiquitinated histone H2A destabilizes photolesion-containing nucleosomes with concomitant release of UV-damaged DNA-binding protein E3 ligase.
22118460 2011 The molecular basis of CRL4DDB2/CSA ubiquitin ligase architecture, targeting, and activation.
21816345 2011 X-linked mental retardation gene CUL4B targets ubiquitylation of H3K4 methyltransferase component WDR5 and regulates neuronal gene expression.
21795677 2011 Cullin 4B protein ubiquitin ligase targets peroxiredoxin III for degradation.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21352845 2011 CUL4B-deficiency in humans: understanding the clinical consequences of impaired Cullin 4-RING E3 ubiquitin ligase function.
21269460 2011 Initial characterization of the human central proteome.
20951943 2010 Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.
20932471 2010 CRL4(Cdt2) regulates cell proliferation and histone gene expression by targeting PR-Set7/Set8 for degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064923 2010 Mutations in Cullin 4B result in a human syndrome associated with increased camptothecin-induced topoisomerase I-dependent DNA breaks.
20005570 2010 Cullins in human intra-uterine growth restriction: expressional and epigenetic alterations.
20002452 2010 A novel nonsense mutation in CUL4B gene in three brothers with X-linked mental retardation syndrome.
19818632 2009 CRL4s: the CUL4-RING E3 ubiquitin ligases.
19801544 2009 Characterization of nuclear localization signal in the N terminus of CUL4B and its essential role in cyclin E degradation and cell cycle progression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
19295130 2009 An interaction network of the mammalian COP9 signalosome identifies Dda1 as a core subunit of multiple Cul4-based E3 ligases.
19056892 2008 A functional link between Wnt signaling and SKP2-independent p27 turnover in mammary tumors.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18794347 2008 PCNA-dependent regulation of p21 ubiquitylation and degradation via the CRL4Cdt2 ubiquitin ligase complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593899 2008 The cullin 4B-based UV-damaged DNA-binding protein ligase binds to UV-damaged chromatin and ubiquitinates histone H2A.
18235224 2008 mTORC1 signaling requires proteasomal function and the involvement of CUL4-DDB1 ubiquitin E3 ligase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17392787 2007 Dioxin receptor is a ligand-dependent E3 ubiquitin ligase.
17273978 2007 Mutation in CUL4B, which encodes a member of cullin-RING ubiquitin ligase complex, causes X-linked mental retardation.
17236139 2007 Mutations in CUL4B, which encodes a ubiquitin E3 ligase subunit, cause an X-linked mental retardation syndrome associated with aggressive outbursts, seizures, relative macrocephaly, central obesity, hypogonadism, pes cavus, and tremor.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
16678110 2006 Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16407252 2006 PCNA is a cofactor for Cdt1 degradation by CUL4/DDB1-mediated N-terminal ubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322693 2006 Involvement of CUL4 ubiquitin E3 ligases in regulating CDK inhibitors Dacapo/p27Kip1 and cyclin E degradation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578910 2003 Radiation-mediated proteolysis of CDT1 by CUL4-ROC1 and CSN complexes constitutes a new checkpoint.
12609982 2003 TIP120A associates with cullins and modulates ubiquitin ligase activity.
12504026 2002 CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10978356 2000 JAGGED1 expression in human embryos: correlation with the Alagille syndrome phenotype.
10597293 1999 Covalent modification of all members of human cullin family proteins by NEDD8.
10230407 1999 ROC1, a homolog of APC11, represents a family of cullin partners with an associated ubiquitin ligase activity.
10092517 1999 Identification of NEDD8-conjugation site in human cullin-2.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8681378 1996 cul-1 is required for cell cycle exit in C. elegans and identifies a novel gene family.