Property Summary

NCBI Gene PubMed Count 96
PubMed Score 71.25
PubTator Score 66.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.200 3.7e-04
astrocytic glioma 1.100 1.1e-02
ependymoma 1.300 1.0e-02
oligodendroglioma 1.500 5.8e-03
osteosarcoma -1.223 4.0e-04
atypical teratoid/rhabdoid tumor 1.200 6.9e-08
acute quadriplegic myopathy 1.208 9.8e-05
tuberculosis and treatment for 6 months 1.400 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.4e-03
Breast cancer -2.200 4.9e-02
group 3 medulloblastoma 1.100 7.0e-04
ovarian cancer 1.200 1.2e-03
pituitary cancer -1.300 5.4e-04
cystic fibrosis and chronic rhinosinusit... 1.253 7.1e-03

Gene RIF (95)

PMID Text
26965998 this study proposes that inflammation-induced Jak-STAT3 signaling leads to colon cancer development through proteasomal degradation of DICER1 by ubiquitin ligase complex of CUL4A(DCAF1), which suggests a novel therapeutic opportunity for colon cancer
26684807 Amplification of CUL4A, IRS2, and TFDP1 genes showed a significant difference in disease-free survival by both univariate and multivariate survival analyses in intrahepatic cholangiocarcinoma.
26593394 CUL4A facilitates hepatocarcinogenesis by promoting cell cycle progression and epithelial-mesenchymal transition.
26503734 We observed that knockdown of Cul4A was associated with increased sensitivity to gemcitabine through upregulation of TGFBI in lung cancer cells.
26218750 These results suggest a linkage between Cul4A and Gli1 expression in human mesothelioma.
26104890 PR-Set7 is a direct target of Cul4A for degradation and involved in the formation of lung tumors in the conditional Cul4A transgenic mouse model.
26036759 Our results indicate that CUL4A overexpression play an oncogenic role in the pathogenesis of prostate cancer (PC), and CUL4A may be a potential therapeutic target for PCa.
26021757 Our data are consistent with the idea that the CUL4A/B-DDB1-CRBN complex catalyses the polyubiquitination and thus controls the degradation of CLC-1 channels.
25807049 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
25542213 Results show that CUL4A- and CUL4B-mediated polyubiquitination of gamma-tubulin for its degradation.
25423367 eEF1A1 may mediate SAMHD1 turnover by targeting it to the proteosome for degradation through association with Cullin4A and Rbx1.
25413624 CUL4A regulated EGFR transcriptional expression.
24989250 dysfunctional Pex7p, including mutants from RCDP patients, is degraded by a ubiquitin-dependent proteasomal pathway involving the CRL4A (Cullin4A-RING ubiquitin ligase) complex.
24870930 Our results suggest a synergistic effect between CUL4A high levels and the activation of the RAS pathway in the tumorigenesis of basal-like breast cancer tumors
24744753 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
24719410 HIV-1 Vpr can trigger G2 cell cycle arrest in the absence of either CUL4A or CUL4B.
24719410 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
24648314 Findings indicate that Cul4A is oncogenic in vivo and that Cul4A over-expression is associated with cisplatin resistance in lung cancer cells.
24522884 CUL4A ubiquitin ligase plays a key role in a wide range of cellular processes, including the cell cycle, chromatin remodelling, DNA damage response, DNA replication, spermatogenesis and haematopoiesis.
24452595 we observed an increased level of polyubiquitination on p53 in CUL4B overexpressing stable cell line upon treatment with siRNA specific for CUL4A indicating that CUL4B plays a vital role in p53 stability.
24420924 The results of this study indicated that CUL4A enhances pituitary cell proliferation, migration and invasion and may thus contribute to pituitary tumor development and progression.
24368600 CUL4A and ERK1/2 participated in multi-drug resistance in breast cancer through regulation of MDR1/P-gp expression.
24305877 CUL4A has a pivotal role in regulating the metastatic behavior of breast cancer cells in a process involving ZEB1
24245672 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
24209620 These results indicate that both yeast Rtt101Mms1 and human Cul4ADDB1 are required for efficient deposition of new H3 onto DNA.
24116224 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
24082123 DLC1 was ubiquitinated and degraded by cullin 4A-RING ubiquitin ligase (CRL4A) complex interaction with DDB1 and the FBXW5 substrate receptor.
24045107 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
23849790 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
23085759 p73 interacts with the CDL4A complex by binding directly to DDB1. The CDL4A complex is able to monoubiquitylate p73, negatively affecting its transcriptional function.
23063525 The EZH2-DCAF1/DDB1/CUL4 represents a previously unrecognized methylation-dependent ubiquitination machinery specifically recognizing "methyl degron"; nonhistone protein stability can be dynamically regulated in a methylation-dependent manner.
22952844 potential GRK5 interacting proteins and the association of GRK5 with DDB1 in cell and the regulation of GRK5 level by DDB1-CUL4 ubiquitin ligase complex-dependent proteolysis pathway
22822215 Findings indicate structural and conformational insights of the DDB1-CUL4A(DDB2) E3 ligase, with significant implications for the regulation and overall organization of the proteins responsible for initiation of nucleotide-excision repair (NER) pathway.
22692198 Activation of EGFR inhibits the interaction of PCNA with CUL4A, whereas inhibition of EGFR leads to increased CUL4A-PCNA interaction and CUL4A-dependent ubiquitin-mediated degradation of PCNA
22438978 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
22422151 subjects with tumors that highly expressed CUL4A had poor overall survival and CUL4A downregulation inhibited cell proliferation and induced apoptosis in vitro and in vivo.
22190034 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
22174317 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
22134138 Artemis and DDB2 regulate p27 via the Cul4A-based E3 ligase complex.
22120631 hCUL4A suppresses apoptosis and DNA damage by regulating apoptosis-related proteins and cell cycle regulators (Bcl-2, caspase-3, p53 and p27); consequently, hCUL4A promotes cell survival.
21957298 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
21550341 Studies indicate the modular architecture of DDB1-CUL4 in complex with DDB2, CSA and CDT2 in DNA repair of UV-induced DNA lesions.
21205828 the CUL4A.DDB1 E3 complex is important for regulation of RASSF1A during mitosis, and it may contribute to inactivation of RASSF1A and promoting cell cycle progression
20951943 Increased PRMT5 activity mediates key events associated with cyclin D1-dependent neoplastic growth, including CUL4 repression, CDT1 overexpression, and DNA rereplication.
20932471 This study identifies CRL4-Cdt2 ubiquitin ligase to promote the ubiquitin-dependent proteolysis of the histone H4 methyltransferase Set8 during S-phase of the cell cycle and after UV-irradiation in a reaction that is dependent on PCNA.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20395298 DDB1 modulates the function of APC/C(Cdh1) in a manner independent of the Cul4-DDB1 complex
20380700 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
20347598 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
20069611 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
20064923 the interplay between CUL4A and CUL4B in pathogenesis of CUL4B-deficiency in humans
20012529 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
20008788 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
19995430 13q34 amplification may be of relevance in tumor progression of breast cancers by inducing overexpression of CUL4A and TFDP1, important in cell cycle regulation. These genes were also overexpressed in non-basal-like tumor samples.
19929949 study indicates that Cul4A amplification and overexpression play an oncogenic role in the pathogenesis of mesothelioma
19818632 Studies indicate that CUL4 uses a large beta-propeller protein, DDB1, as a linker to interact with a subset of WD40 proteins.
19798433 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
19667756 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
19557001 Data show that REDD1 is subject to ubiquitin-mediated degradation mediated by the CUL4A-DDB1-ROC1-beta-TRCP E3 ligase complex and through the activity of glycogen synthase kinase 3beta.
19458171 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
19295130 Cells depleted of Dda1 spontaneously accumulated double-stranded DNA breaks in a similar way to Cul4A-, Cul4B- or Wdr23-depleted cells, indicating that Dda1 interacts physically and functionally with cullin-RING E3 ligases complexes.
19275588 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
19275585 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
19208841 DDB1-CUL4 and MLL1 complexes constitute a novel pathway that mediates p16 activation during oncogenic checkpoint response.
19056892 CUL4A and CUL4B are therefore components of a conserved Wnt-induced proteasome targeting (WIPT) complex that regulates p27(KIP1) levels and cell cycle progression in mammalian cells.
18703516 CDK inhibitor p21 is degraded by a proliferating cell nuclear antigen-coupled Cul4-DDB1Cdt2 pathway during S phase and after UV irradiation
18606781 Data show that human immunodeficiency virus type 1 Vpr-binding protein VprBP binds stoichiometrically with DDB1 through its WD40 domain and through DDB1 to CUL4A, subunits of the COP9/signalsome.
18606781 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
18541215 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
18524771 Cul4A-DDB1DCAF1 ubiquitin ligase assembly protects HIV-1 Vpr from proteasomal degradation
18524771 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
18514189 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
18381890 Results indicate that FBW5-DDB1-CUL4-ROC1 is an E3 ubiquitin ligase regulating TSC2 protein stability and TSC complex turnover.
18332868 VprBP depletion abolished the in vivo interaction of Merlin and Roc1-Cullin4A-DDB1, which resulted in Merlin stabilization and inhibited ERK and Rac activation
17855541 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
17630831 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
17620334 The HIV1 protein Vpr acts to promote G2 cell cycle arrest by engaging a DDB1 and Cullin4A-containing ubiquitin ligase complex using VprBP/DCAF1 as an adaptor.
17609381 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
17452440 These findings demonstrate that the conserved DET1 complex modulates Cul4A functions by a novel mechanism.
17360488 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
17314515 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
16964240 crystallographic analyses of the virally hijacked form of the human DDB1-CUL4A-ROC1 machinery
16951172 DDB2 can bind to damaged DNA in vivo as a monomer, whereas Cul4A recruitment to damage sites depends on the fully assembled complex.
16949367 These studies uncover diverse substrate receptors for Cul4 and identify Cdt2 as a conserved component of the Cul4-Ddb1 E3 that is essential to destroy Cdt1 and ensure proper cell cycle regulation of DNA replication.
16861906 L2DTL and PCNA interact with CUL4/DDB1 complexes and are involved in CDT1 degradation after DNA damage.
16861890 PCNA, L2DTL and the DDB1-CUL4A complex play critical and differential roles in regulating the protein stability of p53 and MDM2/HDM2 in unstressed and stressed cells.
16678110 This study uncovers CUL4-DDB-ROC1 as a histone ubiquitin ligase and demonstrate that histone H3 and H4 ubiquitylation participates in the cellular response to DNA damage.
16537899 The F-box protein Skp2, in addition to utilizing Cul1-Skp1, utilizes Cul4A-DDB1 to induce proteolysis of p27Kip1.
16527807 CUL-4A mediates the proteolytic degradation of DDB2 and this degradation event, initiated at the lesion sites, regulates damage recognition by XPC.
16473935 Monoubiquitinated histone H2A in native chromatin coimmunoprecipitates with the endogenous DDB1-CUL4A(DDB2) complex in response to UV irradiation.
16407252 Cul4A, PCNA, and DDB1 are involved in the degradation of Cdt1 after ultraviolet radiation
16407242 PCNA is involved in mediating Cdt1 degradation by the Cul4-Ddb1 ligase in response to DNA damage.
15548678 role of Cul4A in the MDM2-mediated proteolysis of p53
14739464 DET1 promotes ubiquitination and degradation of c-Jun by assembling a multisubunit ubiquitin ligase containing DNA Damage Binding Protein-1 (DDB1), cullin 4A (CUL4A), Regulator of Cullins-1 (ROC1), and constitutively photomorphogenic-1
12029633 TFDP1, CUL4A, and CDC16 are probable targets of an amplification mechanism and therefore may be involved, together or separately, in development and/or progression of some hepatocellular carcinomas

AA Sequence

MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAV      1 - 70
RAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQ     71 - 140
DHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVD    141 - 210
RSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDH    211 - 280
STQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTA    281 - 350
IVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG    351 - 420
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSK    421 - 490
LEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLG    491 - 560
KHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQS    561 - 630
LACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI    631 - 700
VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA               701 - 759
//

Text Mined References (112)

PMID Year Title
26965998 2016 Jak-STAT3 pathway triggers DICER1 for proteasomal degradation by ubiquitin ligase complex of CUL4A(DCAF1) to promote colon cancer development.
26684807 2015 Recurrent Amplification at 13q34 Targets at CUL4A, IRS2, and TFDP1 As an Independent Adverse Prognosticator in Intrahepatic Cholangiocarcinoma.
26593394 2015 CUL4A facilitates hepatocarcinogenesis by promoting cell cycle progression and epithelial-mesenchymal transition.
26503734 2015 Knockdown of Cul4A increases chemosensitivity to gemcitabine through upregulation of TGFBI in lung cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26218750 2015 Cul4A overexpression associated with Gli1 expression in malignant pleural mesothelioma.
26104890 2015 PR-Set7 is Degraded in a Conditional Cul4A Transgenic Mouse Model of Lung Cancer.
26036759 2015 Clinical significance of CUL4A in human prostate cancer.
26021757 2015 The Cullin 4A/B-DDB1-Cereblon E3 Ubiquitin Ligase Complex Mediates the Degradation of CLC-1 Chloride Channels.
25542213 2015 Cullin 4A and 4B ubiquitin ligases interact with ?-tubulin and induce its polyubiquitination.
25423367 2015 The eukaryotic elongation factor eEF1A1 interacts with SAMHD1.
25413624 2014 CUL4A overexpression enhances lung tumor growth and sensitizes lung cancer cells to erlotinib via transcriptional regulation of EGFR.
24989250 2014 CUL4A-DDB1-Rbx1 E3 ligase controls the quality of the PTS2 receptor Pex7p.
24870930 2014 CUL4A contributes to the biology of basal-like breast tumors through modulation of cell growth and antitumor immune response.
24719410 2014 Cullin4A and cullin4B are interchangeable for HIV Vpr and Vpx action through the CRL4 ubiquitin ligase complex.
24648314 2014 Lung tumourigenesis in a conditional Cul4A transgenic mouse model.
24522884 2014 CUL4A ubiquitin ligase: a promising drug target for cancer and other human diseases.
24452595 2014 E3 ubiquitin ligase Cullin4B mediated polyubiquitination of p53 for its degradation.
24420924 2014 CUL4A is overexpressed in human pituitary adenomas and regulates pituitary tumor cell proliferation.
24368600 2013 Involvement of CUL4A in regulation of multidrug resistance to P-gp substrate drugs in breast cancer cells.
24305877 2014 CUL4A induces epithelial-mesenchymal transition and promotes cancer metastasis by regulating ZEB1 expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24209620 2013 A Cul4 E3 ubiquitin ligase regulates histone hand-off during nucleosome assembly.
24082123 2013 CRL4A-FBXW5-mediated degradation of DLC1 Rho GTPase-activating protein tumor suppressor promotes non-small cell lung cancer cell growth.
24076655 2013 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
23478445 2013 CRL1-FBXO11 promotes Cdt2 ubiquitylation and degradation and regulates Pr-Set7/Set8-mediated cellular migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085759 2013 The Cul4A-DDB1 E3 ubiquitin ligase complex represses p73 transcriptional activity.
23063525 2012 EZH2 generates a methyl degron that is recognized by the DCAF1/DDB1/CUL4 E3 ubiquitin ligase complex.
22952844 2012 Targeted ubiquitination and degradation of G-protein-coupled receptor kinase 5 by the DDB1-CUL4 ubiquitin ligase complex.
22935713 2012 Orc2 protects ORCA from ubiquitin-mediated degradation.
22822215 2012 Damaged DNA induced UV-damaged DNA-binding protein (UV-DDB) dimerization and its roles in chromatinized DNA repair.
22692198 2012 Epidermal growth factor receptor protects proliferating cell nuclear antigen from cullin 4A protein-mediated proteolysis.
22422151 2012 Oncogenic CUL4A determines the response to thalidomide treatment in prostate cancer.
22157821 2012 VprBP binds full-length RAG1 and is required for B-cell development and V(D)J recombination fidelity.
22134138 2011 Artemis interacts with the Cul4A-DDB1DDB2 ubiquitin E3 ligase and regulates degradation of the CDK inhibitor p27.
22120631 2011 Overexpression of the human ubiquitin E3 ligase CUL4A alleviates hypoxia-reoxygenation injury in pheochromocytoma (PC12) cells.
22118460 2011 The molecular basis of CRL4DDB2/CSA ubiquitin ligase architecture, targeting, and activation.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21550341 2011 Detecting UV-lesions in the genome: The modular CRL4 ubiquitin ligase does it best!
21269460 2011 Initial characterization of the human central proteome.
21205828 2011 Cullin-4A·DNA damage-binding protein 1 E3 ligase complex targets tumor suppressor RASSF1A for degradation during mitosis.
21113133 2010 RNAi-based screening identifies the Mms22L-Nfkbil2 complex as a novel regulator of DNA replication in human cells.
20951943 2010 Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.
20932471 2010 CRL4(Cdt2) regulates cell proliferation and histone gene expression by targeting PR-Set7/Set8 for degradation.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20395298 2010 Damaged DNA-binding protein 1 (DDB1) interacts with Cdh1 and modulates the function of APC/CCdh1.
20223979 2010 Identification of a primary target of thalidomide teratogenicity.
20190741 2010 A deneddylase encoded by Epstein-Barr virus promotes viral DNA replication by regulating the activity of cullin-RING ligases.
20129063 2010 CRL4(Cdt2) E3 ubiquitin ligase monoubiquitinates PCNA to promote translesion DNA synthesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064923 2010 Mutations in Cullin 4B result in a human syndrome associated with increased camptothecin-induced topoisomerase I-dependent DNA breaks.
19995430 2009 Comprehensive characterization of the DNA amplification at 13q34 in human breast cancer reveals TFDP1 and CUL4A as likely candidate target genes.
19929949 2011 Cul4A is an oncogene in malignant pleural mesothelioma.
19818632 2009 CRL4s: the CUL4-RING E3 ubiquitin ligases.
19557001 2009 REDD1, an inhibitor of mTOR signalling, is regulated by the CUL4A-DDB1 ubiquitin ligase.
19481525 2009 CUL4A abrogation augments DNA damage response and protection against skin carcinogenesis.
19295130 2009 An interaction network of the mammalian COP9 signalosome identifies Dda1 as a core subunit of multiple Cul4-based E3 ligases.
19208841 2009 DDB1-CUL4 and MLL1 mediate oncogene-induced p16INK4a activation.
19056892 2008 A functional link between Wnt signaling and SKP2-independent p27 turnover in mammary tumors.
18794347 2008 PCNA-dependent regulation of p21 ubiquitylation and degradation via the CRL4Cdt2 ubiquitin ligase complex.
18703516 2008 CDK inhibitor p21 is degraded by a proliferating cell nuclear antigen-coupled Cul4-DDB1Cdt2 pathway during S phase and after UV irradiation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18606781 2008 Human immunodeficiency virus type 1 Vpr-binding protein VprBP, a WD40 protein associated with the DDB1-CUL4 E3 ubiquitin ligase, is essential for DNA replication and embryonic development.
18524771 2008 Assembly with the Cul4A-DDB1DCAF1 ubiquitin ligase protects HIV-1 Vpr from proteasomal degradation.
18381890 2008 WD40 protein FBW5 promotes ubiquitination of tumor suppressor TSC2 by DDB1-CUL4-ROC1 ligase.
18332868 2008 VprBP targets Merlin to the Roc1-Cul4A-DDB1 E3 ligase complex for degradation.
17620334 2007 The HIV1 protein Vpr acts to promote G2 cell cycle arrest by engaging a DDB1 and Cullin4A-containing ubiquitin ligase complex using VprBP/DCAF1 as an adaptor.
17452440 2007 Mammalian DET1 regulates Cul4A activity and forms stable complexes with E2 ubiquitin-conjugating enzymes.
17254749 2007 Characterization of cullin-based E3 ubiquitin ligases in intact mammalian cells--evidence for cullin dimerization.
17085480 2006 DTL/CDT2 is essential for both CDT1 regulation and the early G2/M checkpoint.
17079684 2006 DDB1 functions as a linker to recruit receptor WD40 proteins to CUL4-ROC1 ubiquitin ligases.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16951172 2006 DNA damage binding protein component DDB1 participates in nucleotide excision repair through DDB2 DNA-binding and cullin 4A ubiquitin ligase activity.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
16861906 2006 L2DTL/CDT2 interacts with the CUL4/DDB1 complex and PCNA and regulates CDT1 proteolysis in response to DNA damage.
16861890 2006 L2DTL/CDT2 and PCNA interact with p53 and regulate p53 polyubiquitination and protein stability through MDM2 and CUL4A/DDB1 complexes.
16678110 2006 Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.
16537899 2006 Cul4A and DDB1 associate with Skp2 to target p27Kip1 for proteolysis involving the COP9 signalosome.
16527807 2006 Cullin 4A-mediated proteolysis of DDB2 protein at DNA damage sites regulates in vivo lesion recognition by XPC.
16482215 2006 Two E3 ubiquitin ligases, SCF-Skp2 and DDB1-Cul4, target human Cdt1 for proteolysis.
16473935 2006 The DDB1-CUL4ADDB2 ubiquitin ligase is deficient in xeroderma pigmentosum group E and targets histone H2A at UV-damaged DNA sites.
16407252 2006 PCNA is a cofactor for Cdt1 degradation by CUL4/DDB1-mediated N-terminal ubiquitination.
16407242 2006 An evolutionarily conserved function of proliferating cell nuclear antigen for Cdt1 degradation by the Cul4-Ddb1 ubiquitin ligase in response to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16137618 2005 Genotoxic stress targets human Chk1 for degradation by the ubiquitin-proteasome pathway.
15811626 2005 DDB2, the xeroderma pigmentosum group E gene product, is directly ubiquitylated by Cullin 4A-based ubiquitin ligase complex.
15548678 2004 Cul4A physically associates with MDM2 and participates in the proteolysis of p53.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448697 2004 Targeted ubiquitination of CDT1 by the DDB1-CUL4A-ROC1 ligase in response to DNA damage.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14739464 2004 Human De-etiolated-1 regulates c-Jun by assembling a CUL4A ubiquitin ligase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14609952 2003 CUL-4A stimulates ubiquitylation and degradation of the HOXA9 homeodomain protein.
14578910 2003 Radiation-mediated proteolysis of CDT1 by CUL4-ROC1 and CSN complexes constitutes a new checkpoint.
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12609982 2003 TIP120A associates with cullins and modulates ubiquitin ligase activity.
12504026 2002 CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.
12504025 2002 NEDD8 modification of CUL1 dissociates p120(CAND1), an inhibitor of CUL1-SKP1 binding and SCF ligases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12029633 2002 TFDP1, CUL4A, and CDC16 identified as targets for amplification at 13q34 in hepatocellular carcinomas.
11673459 2001 UV-damaged DNA-binding proteins are targets of CUL-4A-mediated ubiquitination and degradation.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
10597293 1999 Covalent modification of all members of human cullin family proteins by NEDD8.
10230407 1999 ROC1, a homolog of APC11, represents a family of cullin partners with an associated ubiquitin ligase activity.
9721878 1998 The human homologue for the Caenorhabditis elegans cul-4 gene is amplified and overexpressed in primary breast cancers.
9694792 1998 A new NEDD8-ligating system for cullin-4A.
8681378 1996 cul-1 is required for cell cycle exit in C. elegans and identifies a novel gene family.