Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.17
PubTator Score 0.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 2.018 7.7e-08
ependymoma 1.200 7.8e-12
astrocytoma 1.100 4.3e-02
atypical teratoid / rhabdoid tumor 1.100 7.7e-04
primitive neuroectodermal tumor 1.200 2.8e-04
hereditary spastic paraplegia 1.013 4.6e-03
ovarian cancer 1.300 1.2e-04

Synonym

Accession Q9NWM3 D3DTZ2 Q9NWD0
Symbols

Gene

PDB

2DHY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPNMDYDIIECVL      1 - 70
RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEPDSSDEEPPPVYSPPAYHMHV     71 - 140
FDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGNLPDDFLRILPQQLDSIQGNAGGPKPGSGEG    141 - 210
CPPAMAGPGPGDQESRWKQYLEDERIALFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGN    211 - 280
DFGFSSPVPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAA    281 - 350
STANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ                                      351 - 386
//

Text Mined References (6)

PMID Year Title
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.