Property Summary

NCBI Gene PubMed Count 206
PubMed Score 411.24
PubTator Score 375.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.700 1.0e-03
hepatocellular carcinoma 1.400 2.7e-03
pancreatic cancer 2.500 3.1e-05
malignant mesothelioma -2.200 1.1e-06
psoriasis -1.700 6.2e-05
medulloblastoma -1.200 2.2e-06
adrenocortical carcinoma -1.254 2.0e-03
pancreatic ductal adenocarcinoma liver m... 1.406 9.0e-04
non-small cell lung cancer 2.239 2.4e-14
intraductal papillary-mucinous adenoma (... 1.100 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.800 6.3e-03
lung cancer 2.500 8.1e-04
pancreatic carcinoma 2.500 3.1e-05
subependymal giant cell astrocytoma 2.173 1.1e-02
spina bifida -2.456 3.6e-02
Breast cancer 1.100 5.1e-05
mucosa-associated lymphoid tissue lympho... 1.595 6.1e-03
invasive ductal carcinoma 1.200 3.3e-02
ovarian cancer 1.700 1.7e-04

 IMPC Phenotype (1)

Gene RIF (150)

PMID Text
26602019 findings reveal that Keap1 regulates cell migration by affecting the subcellular localization and activity of cortactin independently of its role in oxidant stress responses.
26490115 the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2
26385474 Study highlights the potential role of CCM3 in regulating tight junction complex organization and brain endothelial barrier permeability through CCM3-ERK1/2-cortactin cross-talk
26361873 These findings suggest that this common cortactin variant may functionally contribute to ALI predisposition by impeding endothelial wound healing.
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
26323691 These data suggest a model in which phosphatidylinositol 3,5-bisphosphate binding removes cortactin from late endosomal branched actin networks and thereby promotes net actin turnover.
26289258 The results indicate that cortactin is involved in the regulation of apoptosis induced by VacA in gastric cells.
26246421 acetylation-mimicking mutants of alpha-tubulin and cortactin counteract HDAC6-induced ciliary disassembly.
26243395 Cortactin expression in epithelial ovarian carcinoma was closely related to malignant biological behavior
26238396 cortactin is crucial in invasion and migration of glioma cells, which may promote the migration and invasion of glioma cells by regulating lamellipodia formation, a process requiring the combination of cortactin and the Arp2/3 complex
26151562 Findings show CTTN significantly upregulated in colon cancer, while its ectopic expression promotes cell proliferation and tumorigenicity through EGFR-ERK pathway regulation suggesting that CTTN plays an important role in colon cancer progression.
26134506 Studied the expression of cortactin in HCT116 cells treated with one of the major components of Chansu, Cinobufagin.
26112958 Dysregulation of cortactin and HDAC6 is implicated in the invasiveness and migration of prostate cancer cells.
26096820 Host cortactin, PKD1 and actin are recruited by Trypanosoma cruzi extracellular amastigotes based on experiments in fixed and live cells by time lapse confocal microscopy.
25848070 This review focuses on recently published evidence that endothelial ABPs, such as cortactin, myosin, or alpha-actinin, regulate leukocyte extravasation by controlling actin dynamics, biomechanical properties of endothelia, and signaling pathways
25631074 Cellular biotinylated cortactin (CTTN) protein is incorporated into HIV-1 Gag virus-like particles
25601713 The cortactin SH3 domain contributes to podosome assembly while fascin actin bundling is a master regulator of podosome disassembly in THP-1 macrophages and dendritic cells.
25385572 These results implicate that the role of MTSS1 suppresses cell migration and invasion by inhibiting expression of CTTN and as a prognosis biomarker in Glioblastomas
25271301 Integrated omic analysis of oropharyngeal carcinomas reveals human papillomavirus-dependent regulation of the AP-1 pathway and elevated cortactin protein levels.
25212831 Upregulation of CTTN is critical for Vascular endothelial growth factor-C- mediated tumor growth and metastasis of esophageal squamous cell carcinoma.
25205106 Mechanistic investigations showed that VEGF-C increased CTTN expression by downregulating Dicer-mediated maturation of miR326, thereby relieving the suppressive effect of miR326 on CTTN expression.
25022754 Studies show that IQGAP1 functions as a hub linking HGF-induced signaling to microtubules and actin remodeling via EB1-IQGAP1-cortactin interactions.
24970760 These findings show that overexpression of PODXL enhanced invadopodia formation and tumor metastasis by inducing Rac1/Cdc42/cortactin signaling network.
24920679 expression of a charge-neutralizing cortactin mutant inhibited contraction and actin dynamics during contractile activation.
24891505 Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin.
24867096 Data suggest a mechanism for the negative regulation of cortactin by FBXL5 protein in gastric cancer cells migration.
24861866 These observations support a signaling network among JNKs, Smads, Snail1, and cortactin to regulate the invasion of MDA-MB-231 cells embedded in 3D collagen I, which may be targeted during screening of anti-invasion reagents.
24700464 association of cortactin with Pfn-1 is regulated by c-Abl-mediated cortactin phosphorylation
24696610 Cortactin expression promoted the migration, invasion and proliferation of SGC-7901 cells both in vivo and in vitro
24652832 c-src-mediated phosphorylation requires RTPAalpha
24551190 Overexpression of cortactin (CTTN) was observed in 126/198 (63.6%) of esophageal squamous cell carcinoma cases and was significantly associated with lymph node metastasis (P = 0.000), pathologic stage (P = 0.000) and poor survival (P<0.001).
24549769 The present study demonstrated that bladder cancer cells with cortactin knockdown have a reduced capacity to extravasate into the lung from the circulation, due to the decreased invasive character of invadopodia.
24532043 Cortactin, another player in the Lyn signaling pathway, is over-expressed and alternatively spliced in leukemic cells from patients with B-cell chronic lymphocytic leukemia.
24469447 Cortactin has a role as a scaffold for Arp2/3 and WAVE2 at the epithelial zonula adherens
24465712 Data suggest that curcumin is an activator of non-receptor type 1 protein tyrosine phosphatase (PTPN1) and can reduce cell motility in colon cancer via dephosphorylation of pTyr(421)-cortactin (CTTN).
24414419 Data indicate the specific contribution of fascin and cortactin during invadopodium formation.
24409670 Combining cortactin and CTTN mRNA detection with clinicopathologic features improved the predictive power. High expression of both cortactin and CTTN indicated poor survival time of 12 +/- 3.67 months and low expression indicated longer survival time
24265417 GIT1-cortactin association through GIT1-Spa homology domain is required for cortactin localization to the leading edge and is essential for endothelial cell directional migration and tumor angiogenesis.
24120646 Results suggest that elevated shear stress induces MUC5AC hypersecretion via tyrosine-phosphorylated cortactin-associated actin polymerization in cultured human airway epithelial cells.
23991004 Data indicate that luteolin and quercetin attenuate the phosphorylation of cortactin and Src, disruption of invadopodia generation suppression of matrix metalloproteinase MMP9 secretion, and reduction in metastasis.
23702379 Suggest that SIRT1 and cortactin may play a role in the progression of non-small cell lung cancer and may cooperate during tumor progression in NSCLC.
23518204 Overexpression of cortactin is closely associated with liver embolus and metastasis.
23161539 results suggest that SKAP2 negatively regulates cell migration and tumor invasion in fibroblasts and glioblastoma cells by suppressing actin assembly induced by the WAVE2-cortactin complex
23144454 Cortactin controls surface expression of the voltage-gated potassium channel K(V)10.1.
23030700 overexpression of cortactin and fascin-1 implies poorer tumor differentiation, advanced AJCC stage, and shorter survival rate in pancreatic and ampulla of Vater adenocarcinomas
22991200 Regulation of late endosomal/lysosomal maturation and trafficking by cortactin affects Golgi morphology.
22944623 cortactin seems to be a satisfactory marker to predict tumour progression and survival in cases of prostate cancer.
22768099 A cooperative interplay between FAK, Src and cortactin enables endocytosis of N. meningitidis into host cells.
22378044 Dephosphorylation of FAK upon inhibition of beta integrin resulted in dissociation of a FAK/cortactin protein complex. This, in turn, downregulated JNK signaling and induced cell rounding, leading to radiosensitization.
22377015 Strong immunoexpression of cortactin is a predicting factor for increased cancer risk in oral premalignant lesions.
22297550 Over-expression of cortactin, contained in the 11q13 amplicon, is involved in osteosarcoma carcinogenesis.
22282019 a complex containing cortactin and RCC2/TD60 complex that may play a functional role in cells undergoing mitosis.
22219181 MLCK is essential for the translocation and association of cortactin and p47phox.
22117553 These results suggest that the actin binding protein cortactin is required for actin stress fiber formation in muscle cells and that this process is absolutely required for translocation of GLUT4-containing vesicles to the plasma membrane.
22105349 Cortactin phosphorylation, local pH increase, and cofilin activation regulates the dynamic cycles of invadopodium protrusion and retraction and is essential for cell invasion in 3D.
22089141 HDAC6 promotes the migration and invasion of bladder cancer cells by targeting the cytoskeletal protein cortactin.
22078467 The cortactin acts as a bridging molecule between actin filaments and focal adhesions.
22050448 Knockdown of cortactin or silent mating type information regulation 2 homolog 1 expression inhibited both migration and invasion of DU145 prostate cancer cells.
22007770 We demonstrated cortactin and MT1-MMP expression in ameloblastoma.
21858086 Data suggest that GEP100-Arf6-AMAP1-cortactin pathway, activated by VEGFR2, appears to be common in angiogenesis and cancer invasion and metastasis, and provides their new therapeutic targets.
21856159 Both motility and lamellipodial defects of cortactin-KD cells were fully rescued by plating on increasing concentrations of exogenous extracellular matrix (ECM). Cortactin-KD cell speed defects were not rescued on ECM produced by cortactin-KD cells.
21669400 Cortactin interacts with and stimulates the kinase activity of focal adhesion kinase upon Helicobacter pylori infection.
21646305 Cortactin and focal adhesion kinase have roles in cancer risk in patients with laryngeal premalignancy
21562571 These data suggest that the acetylation status of CTTN modulated by the NACC1-HDAC6 deacetylation system induces acceleration of melanoma cell migration activity via an actin-dependent cellular process
21503569 Endogenous mature miR-182 expression may have an important role in the pathogenesis of lung cancer through its interference with the target gene CTTN by epigenetic modification.
21474972 Actinin-1 and cortactin showed matrix-contact-side localization in adenocarcinoma cells.
21419472 cases of squamous cell laryngeal carcinoma with absent to weak expression of CTTN in the deep invasive front showed good prognosis parameters, and a second group with moderate to strong expression of CTTN were associated with an unfavorable prognosis
21418910 Endocytosis in colon cancer cells is dependent on an intact expression of CTTN.
21395182 EMS1 expression was positively related to DcR3, which might play an important role in the carcinogenesis and development of laryngeal carcinoma.
21373848 TPM4, PDIA and SRC8 were also localized to the trophoblast cells, further highlighting the importance of these cytoskeletal remodelling proteins in early pregnancy
21258212 Cortactin overexpression has been found in many cancer types, including melanomas, ovarian, gastric, hepatic, colorectal and esophageal. (Review)
21257711 Our findings suggest a novel mechanism by which an EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion
21079800 Data show that concurrent phosphorylation of cortactin by ERK1/2 and tyrosine kinases enables cells with the ability to regulate actin dynamics.
20805359 novel mechanism for regulation of proliferation in 11q13-amplified HNSCC cells, in which overexpressed cortactin acts via RhoA to decrease expression of Cip/Kip CDKIs, and highlight Skp2 as a downstream effector for RhoA in this process
20363754 Protein kinase D controls actin polymerization and cell motility through phosphorylation of cortactin
20213079 CTTN is consistently co-amplified with CCND1 and expressed at higher levels in breast cancers harbouring 11q13 amplification, suggesting that CTTN may also constitute one of the drivers of this amplicon.
20069395 In 70 primary oral squamous cell carcinomas and 10 normal oral mucosal specimens, cortactin expression was evaluated by immunological analyses, and the correlations of the overexpression of cortactin with clinicopathologic factors were evaluated.
20053363 Data provide insights into the molecular basis for vascular barrier-regulatory cytoskeletal responses and quantified the critical interactions between non-muscle MLCK isoenzymes and cortactin during vascular barrier regulation.
19947248 The quantity and percentage of EMS1 protein expression in laryngeal carcinoma tissues was significantly higher than those in para carcinoma and in normal laryngeal mucosa tissues.
19898426 Our data support a potential role of aberrant cortactin expression in melanoma tumor progression
19885550 TocP markedly exerted anti-invasive activities through alteration of cortactin distribution
19885549 localization of cortactin in cancer cells and interaction between ZO-1 and cortactin are crucial for cancer progression.
19684620 This study not only reveals a role of CRT in motility promotion and anoikis resistance in ESCC cells, but also identifies CRT as an upstream regulator in the CRT-STAT3-CTTN-Akt pathway.
19666237 Results confirm the importance of alterations in CCND1 and CTTN with respect to areca-associated oral squamous cell carcinoma, and demonstrates that there is an early occurrence of amplification of these genes in the risk population.
19589785 HER2 carboxyl-terminal fragments regulate cell migration and cortactin phosphorylation
19457864 SFK and cortactin constitute an important signaling pathway that functionally links E-cadherin adhesion and the actin cytoskeleton
19242064 Higher expression of survivin and cortactin correlates significantly with tumor stages and shorter survival time. Survivin and cortactin may be good biomarkers of aggressiveness of colorectal adenocarcinomas.
19219613 Higher expression of cortactin and survivin significantly correlated with advanced clinicopathological stage in renal cell carcinomas.
19207554 Higher cortactin scores positively related to tumor differentiation of esophageal SqCC. Significantly worse prognosis in patients with high scores of cortactin, poor differentiation, T4 stage, positive for lymph node metastasis and distant metastasis.
18991334 The strong relationship of CTTN amplification/overexpression with prognosis and disease outcome reinforces its role as a driver of 11q13 amplification in HNSCC.
18931703 Overexpression of cortactin is associated with head and neck squamous cell carcinoma.
18776588 Cortactin, fascin-1 and EGFR have roles in progression of ovarian carcinomas
18678675 These results imply that cortactin is recruited to the site of EHEC adhesion in vitro and ex vivo by different mechanisms and suggest that cortactin might have a role during EHEC infection of mucosal surfaces.
18607838 Overexpression of cortactin is associated with head and neck squamous cell carcinomas
18521921 CTTN gene variation may contribute to severe asthma
18521921 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18406052 many studies have documented a role for cortactin in promoting cell motility and invasion, including a critical role in invadopodia, actin rich-subcellular protrusions associated with degradation of the extracellular matrix by cancer cells.
18403644 These results suggest that cortactin hyperphosphorylation suppresses cell migration possibly through the inhibition of membrane localization and tyrosine phosphorylation of p130Cas.
18387954 PTP1B regulates cortactin tyrosine phosphorylation by targeting Tyr446
18342393 potential mechanisms by which cortactin may link vesicular trafficking and dynamic branched actin assembly to regulate protease secretion for invadopodia-associatedextracellular matrix degradation
18334127 EMS1 protein expression is related to the carcinogenesis, lymph node metastasis and clinical stage of gastric carcinoma.
18039661 tyrosine protein phosphorylation regulates large conductance voltage- and calcium-activated potassium channels via cortactin
17959782 cortactin-mediated actin remodeling in excitable cells is not only important for cell structure, but may directly impact membrane excitability
17702746 CD44 is an important regulator of HGF/c-Met-mediated in vitro and in vivo barrier enhancement, a process with essential involvement of Tiam1, Rac1, dynamin 2, and cortactin.
17643370 in addition to its role in microtubule-dependent cell motility, HDAC6 influences actin-dependent cell motility by altering the acetylation status of cortactin, which, in turn, changes the F-actin binding activity of cortactin
17627624 Using a variety of approaches including siRNA, expression of dominant negative derivatives and pharmacological inhibitors, Results demonstrate the crucial role of cortactin in the activation of the Arp2/3 complex during InlA-mediated entry.
17576929 Cortactin and p120 are shown to directly interact with each other via the cortactin N-terminal region
17562703 cortactin and actin have roles in hyperoxia-induced activation of NADPH oxidase and ROS generation in human lung endothelial cells
17510372 Higher intensity of cortactin and fascin-1 staining correlated directly with more-advanced cancer stages (TNM) and inversely with survival rates.
17483334 A major role of cortactin in invadopodia is to regulate the secretion of MMPs and point to a novel mechanism coupling dynamic actin assembly to the secretory machinery, producing enhanced ECM degradation and invasiveness.
17451412 Cortactin binding to EHEC virulence factors, Tir and EspF(u), is dependent upon tyrosine phosphorylation during infection.
17449030 These results indicate that cortactin is involved in keratinocyte migration promoted by both KGF and FGF10.
17292556 cortactin-mediated signaling pathways, with emphasis on its contribution to tumor progression and metastasis formation.[REVIEW]
17178864 CTTN is an oncogene in the 11q13 amplicon and exerts functions on tumor metastasis in esophageal squamous cell carcinoma.
17056576 Tyrosine phosphorylation of cortactin dynamically links ICAM-1 to the actin cytoskeleton, enabling ICAM-1 to form clusters and facilitate leukocyte transmigration.
17005439 data suggested potential roles in oral carcinogenesis and that TAOS1 might be involved earlier than EMS1. Both genes might be candidate biomarkers for diagnosis and prognosis in OSCC
16937268 Controls osteoclastic bone resorption by regulating actin organization.
16905744 Plays important role in CXCR4 signaling and trafficking as well as in receptor-mediated cell migration.
16825658 Results suggest that ATP-mediated barrier protection is associated with cytoskeletal activation and is dependent on both Rac activation and cortactin.
16825425 The identification of 17 new sites of phosphorylation in cortactin is reported.
16815198 EMS1 amplification is uncommon and appears to be late event in the development of ethmoid sinus adenocarcinoma.
16652145 functional importance of cortactin to CD44s-promoted metastasis was demonstrated by selective suppression of cortactin in CD44-expressing MCF7F-B5 and MDA-MB-231 breast cancer cells using RNAi
16636290 Results suggest that the AMAP1/cortactin complex, which is not detected in normal mammary epithelial cells, is an excellent drug target for cancer therapeutics.
16611226 Cortactin is a requirement for pedestal formation and suggest a novel function for the predicted alpha-helical region of cortactin in actin assembly induced by EPEC and EHEC.
16527272 Increased levels of cortactin, as found in human carcinomas, promote cell migration and invasion by reducing cell spreading and intercellular adhesive strength.
16489553 Our findings suggest that cortactin plays a role in Listeria internalization, but not in the formation of actin clouds and tails, or in bacteria intracellular motility.
16442522 Co-localization of cortactin and phosphotyrosine identifies invadopodial complexes closely associated with the plasma membrane at active sites of focal degradation of the extracellular matrix in breast cancer cells.
16416022 We describe that S1P-stimulated cortactin translocation to the cell periphery to form lamellipodia is specifically mediated by the endothelial S1P1 G-protein coupled receptor, and is regulated by G(i)-mediated Akt-dependent S1P1 receptor phosphorylation.
16385081 Tyrosine phosphorylation of cortactin by Src family kinases regulates neutrophil transmigration.
16280034 cortactin is the crucial gene within the 11q13 amplicon that mediates the invasive potential of human carcinomas
16261345 Our results demonstrated the dominant expression of p85 form of cortactin in colorectal cancer for the first time.
16076899 Cortactin recruitment is dependent on the activation of a phosphoinositide-3-kinase/Rac1-GTPase signalling pathway, which is required for actin polymerization and internalization of N. meningitidis.
16051170 Cortactin promotes cell motility by enhancing lamellipodial persistence, at least in part through regulation of Arp2/3 complex.
15842855 EMS1 amplification parallels with the progress of oral carcinogenesis.
15618548 The p47phox:actin interaction, through cortactin, plays an important role in Ang II-mediated site-directed assembly of functionally active NAD(P)H oxidase, ROS generation, and activation of redox-sensitive p38MAP kinase and Akt, but not ERK1/2.
15579908 cortactin can restrict N-WASP localization around EGF-bead-induced protrusions
15464244 Overexpression of cortactin may play a role in the metastasis of HCC by influencing cell motility, and cortactin could be a sensitive marker for HCC with intrahepatic metastasis.
15263018 a major role for a Crk-cortactin complex in actin polymerization downstream of tyrosine kinase signaling
15242766 Suppression of cortactin expression with a cortactin antisense oligo significantly impaired S1P-induced capillary formation, migration of endothelial cells, and actin assembly at the cell periphery.
15169891 Erk phosphorylation liberates the SH3 domain of cortactin from intramolecular interactions with proline-rich regions, causing it to synergize with WASP and N-WASP in activating the Arp2/3 complex
15159385 HAX-1 binds bile salt export protein (BSEP), cortactin, MDR1, and MDR2. HAX-1 and cortactin regulate BSEP abundance in the apical membrane of cells.
15123640 Data suggest that hyaluronan-CD44 interaction with Rac1-protein kinase N gamma plays a pivotal role in phospholipase C gamma1-regulated calcium signaling and cortactin-cytoskeleton function required for keratinocyte cell-cell adhesion and differentiation.
15064355 RhoGAP functionally interacts with cortactin and represents a novel determinant in the regulation of cell dynamics.
15056655 cortactin and EC myosin light chain kinase have roles in mediating lung vascular barrier augmentation evoked by S1P
12952985 alternative splicing of the F-actin binding domain of cortactin is a new mechanism by which cortactin influences cell migration
12672817 cortactin links receptor endocytosis to actin polymerization by binding both CD2AP and the Arp2/3 complex, which may facilitate the trafficking of internalized growth factor receptors
12453877 Cdc42/Rac1-dependent activation of PAK may trigger early platelet shape change, at least in part through the regulation of cortactin binding to PAK.
12060669 The Src-cortactin pathway is required for clustering of E-selectin and ICAM-1 in endothelial cells
11988077 Primary arrest of circulating platelets on collagen involves phosphorylation of Syk, cortactin and focal adhesion kinase
11689006 substrate for caspase cleavage during apoptosis

AA Sequence

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK      1 - 70
EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE     71 - 140
YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA    141 - 210
VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQ    211 - 280
DSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNI    281 - 350
RANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV    351 - 420
YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYE    421 - 490
NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ              491 - 550
//

Text Mined References (225)

PMID Year Title
26602019 2015 The subcellular localization and activity of cortactin is regulated by acetylation and interaction with Keap1.
26490115 2015 PLC?3 mediates cortactin interaction with WAVE2 in MCP1-induced actin polymerization and cell migration.
26385474 2015 PDCD10 (CCM3) regulates brain endothelial barrier integrity in cerebral cavernous malformation type 3: role of CCM3-ERK1/2-cortactin cross-talk.
26361873 2015 A genetic variant of cortactin linked to acute lung injury impairs lamellipodia dynamics and endothelial wound healing.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
26323691 2015 PI(3,5)P2 controls endosomal branched actin dynamics by regulating cortactin-actin interactions.
26289258 2016 Cortactin Mediates Apoptosis of Gastric Epithelial Cells Induced by VacA Protein of Helicobacter pylori.
26246421 2015 Deacetylation of ?-tubulin and cortactin is required for HDAC6 to trigger ciliary disassembly.
26243395 2016 Expression and clinical significance of cortactin protein in ovarian neoplasms.
26238396 2015 Expression of cortactin in human gliomas and its effect on migration and invasion of glioma cells.
26151562 2015 Cortactin promotes colon cancer progression by regulating ERK pathway.
26134506 2015 Chansu inhibits the expression of cortactin in colon cancer cell lines in vitro and in vivo.
26112958 2015 Expression and significance of cortactin and HDAC6 in human prostatic foamy gland carcinoma.
26096820 2015 Trypanosoma cruzi extracellular amastigotes trigger the protein kinase D1-cortactin-actin pathway during cell invasion.
25848070 2015 Endothelial actin-binding proteins and actin dynamics in leukocyte transendothelial migration.
25601713 2015 Fascin actin bundling controls podosome turnover and disassembly while cortactin is involved in podosome assembly by its SH3 domain in THP-1 macrophages and dendritic cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25385572 2015 MTSS1 suppresses cell migration and invasion by targeting CTTN in glioblastoma.
25271301 2014 Integrated omic analysis of oropharyngeal carcinomas reveals human papillomavirus (HPV)-dependent regulation of the activator protein 1 (AP-1) pathway.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25212831 2014 Vascular endothelial growth factor-C upregulates cortactin and promotes metastasis of esophageal squamous cell carcinoma.
25205106 2014 miR326 maturation is crucial for VEGF-C-driven cortactin expression and esophageal cancer progression.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25022754 2014 IQGAP1 regulates endothelial barrier function via EB1-cortactin cross talk.
24970760 2014 Podocalyxin-like 1 promotes invadopodia formation and metastasis through activation of Rac1/Cdc42/cortactin signaling in breast cancer cells.
24920679 2014 Histone deacetylase 8 regulates cortactin deacetylation and contraction in smooth muscle tissues.
24891505 2014 Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin.
24867096 2014 FBXL5 targets cortactin for ubiquitination-mediated destruction to regulate gastric cancer cell migration.
24861866 2014 Snail1 induced in breast cancer cells in 3D collagen I gel environment suppresses cortactin and impairs effective invadopodia formation.
24700464 2014 The association of cortactin with profilin-1 is critical for smooth muscle contraction.
24696610 2014 Cortactin expression confers a more malignant phenotype to gastric cancer SGC-7901 cells.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24652832 2014 RPTP? controls epithelial adherens junctions, linking E-cadherin engagement to c-Src-mediated phosphorylation of cortactin.
24551190 2014 Genome-wide gene expression profile analyses identify CTTN as a potential prognostic marker in esophageal cancer.
24549769 2014 Extravasation during bladder cancer metastasis requires cortactin?mediated invadopodia formation.
24532043 2014 Cortactin, another player in the Lyn signaling pathway, is over-expressed and alternatively spliced in leukemic cells from patients with B-cell chronic lymphocytic leukemia.
24469447 2014 Cortactin scaffolds Arp2/3 and WAVE2 at the epithelial zonula adherens.
24465712 2014 pTyr421 cortactin is overexpressed in colon cancer and is dephosphorylated by curcumin: involvement of non-receptor type 1 protein tyrosine phosphatase (PTPN1).
24414419 2014 Stratifying fascin and cortactin function in invadopodium formation using inhibitory nanobodies and targeted subcellular delocalization.
24409670 2013 Combining cortactin and CTTN detection with clinicopathologic features increases effectiveness of survival predictions for patients with resectable hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24265417 2014 G-protein-coupled receptor-2-interacting protein-1 is required for endothelial cell directional migration and tumor angiogenesis via cortactin-dependent lamellipodia formation.
24120646 2013 Cortactin mediates elevated shear stress-induced mucin hypersecretion via actin polymerization in human airway epithelial cells.
23991004 2013 Impact of flavonoids on matrix metalloproteinase secretion and invadopodia formation in highly invasive A431-III cancer cells.
23702379 2013 Expression of SIRT1 and cortactin is associated with progression of non-small cell lung cancer.
23518204 2013 Cortactin is a sensitive biomarker relative to the poor prognosis of human hepatocellular carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161539 2013 The Src substrate SKAP2 regulates actin assembly by interacting with WAVE2 and cortactin proteins.
23144454 2012 Cortactin controls surface expression of the voltage-gated potassium channel K(V)10.1.
23030700 2013 The correlation of cortactin and fascin-1 expression with clinicopathological parameters in pancreatic and ampulla of Vater adenocarcinoma.
22991200 2012 Regulation of late endosomal/lysosomal maturation and trafficking by cortactin affects Golgi morphology.
22944623 2012 Cortactin is associated with tumour progression and poor prognosis in prostate cancer and SIRT2 other than HADC6 may work as facilitator in situ.
22768099 2012 Cell invasion by Neisseria meningitidis requires a functional interplay between the focal adhesion kinase, Src and cortactin.
22378044 2012 ??Integrin/FAK/cortactin signaling is essential for human head and neck cancer resistance to radiotherapy.
22377015 2012 Cortactin and focal adhesion kinase as predictors of cancer risk in patients with premalignant oral epithelial lesions.
22297550 Cortactin (CTTN) overexpression in osteosarcoma correlates with advanced stage and reduced survival.
22282019 2012 Mass spectrometric analysis identifies a cortactin-RCC2/TD60 interaction in mitotic cells.
22252131 2012 Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin.
22219181 2012 Novel role for non-muscle myosin light chain kinase (MLCK) in hyperoxia-induced recruitment of cytoskeletal proteins, NADPH oxidase activation, and reactive oxygen species generation in lung endothelium.
22117553 2011 Cortactin, an actin binding protein, regulates GLUT4 translocation via actin filament remodeling.
22105349 2011 Cortactin phosphorylation regulates cell invasion through a pH-dependent pathway.
22089141 2012 HDAC6 and SIRT2 promote bladder cancer cell migration and invasion by targeting cortactin.
22078467 2011 Tyrosine phosphorylation of cortactin by the FAK-Src complex at focal adhesions regulates cell motility.
22050448 2012 Inhibition of cortactin and SIRT1 expression attenuates migration and invasion of prostate cancer DU145 cells.
22007770 2011 Invadopodia proteins, cortactin and membrane type I matrix metalloproteinase (MT1-MMP) are expressed in ameloblastoma.
21858086 2011 GEP100-Arf6-AMAP1-cortactin pathway frequently used in cancer invasion is activated by VEGFR2 to promote angiogenesis.
21856159 2011 Cortactin controls cell motility and lamellipodial dynamics by regulating ECM secretion.
21847094 2011 Class IIb HDAC6 regulates endothelial cell migration and angiogenesis by deacetylation of cortactin.
21669400 2011 Serine phosphorylation of cortactin controls focal adhesion kinase activity and cell scattering induced by Helicobacter pylori.
21646305 2011 Cortactin and focal adhesion kinase as predictors of cancer risk in patients with laryngeal premalignancy.
21562571 2011 Nucleus accumbens-associated 1 contributes to cortactin deacetylation and augments the migration of melanoma cells.
21503569 2011 microRNA-182 inhibits the proliferation and invasion of human lung adenocarcinoma cells through its effect on human cortical actin-associated protein.
21474972 2011 Localization of the invadopodia-related proteins actinin-1 and cortactin to matrix-contact-side cytoplasm of cancer cells in surgically resected lung adenocarcinomas.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21419472 2011 Cortactin is associated with perineural invasion in the deep invasive front area of laryngeal carcinomas.
21418910 2011 [A pivotal role of cortactin, a CTTN encoding protein, in endocytosis of human colon cancer].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21395182 2010 [The expression of EMS1 and DcR3 protein in laryngeal carcinoma and the relation between EMS1 and DcR3].
21373848 2011 Cytoskeletal remodelling proteins identified in fetal-maternal interface in pregnant women and rhesus monkeys.
21296879 2011 Immunoinhibitory adapter protein Src homology domain 3 lymphocyte protein 2 (SLy2) regulates actin dynamics and B cell spreading.
21269460 2011 Initial characterization of the human central proteome.
21258212 Cortactin: a multifunctional regulator of cellular invasiveness.
21257711 2011 An EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion.
21079800 2010 Cortactin phosphorylated by ERK1/2 localizes to sites of dynamic actin regulation and is required for carcinoma lamellipodia persistence.
20861316 2010 Abl tyrosine kinase phosphorylates nonmuscle Myosin light chain kinase to regulate endothelial barrier function.
20805359 2010 Cortactin modulates RhoA activation and expression of Cip/Kip cyclin-dependent kinase inhibitors to promote cell cycle progression in 11q13-amplified head and neck squamous cell carcinoma cells.
20363754 2010 Protein kinase D controls actin polymerization and cell motility through phosphorylation of cortactin.
20213079 2010 Cortactin gene amplification and expression in breast cancer: a chromogenic in situ hybridisation and immunohistochemical study.
20069395 2010 Overexpression of cortactin increases invasion potential in oral squamous cell carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20053363 2010 Quantitative distribution and colocalization of non-muscle myosin light chain kinase isoforms and cortactin in human lung endothelium.
19947248 2009 [Expression of EMS1 protein and its clinical significance in laryngeal carcinoma].
19898426 2010 Cytoskeleton alterations in melanoma: aberrant expression of cortactin, an actin-binding adapter protein, correlates with melanocytic tumor progression.
19885550 2009 alpha-tocopheryl phosphate suppresses tumor invasion concurrently with dynamic morphological changes and delocalization of cortactin from invadopodia.
19885549 2009 Localization of cortactin is associated with colorectal cancer development.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19684620 2009 Calreticulin promotes cell motility and enhances resistance to anoikis through STAT3-CTTN-Akt pathway in esophageal squamous cell carcinoma.
19666237 2009 Detection of copy number amplification of cyclin D1 (CCND1) and cortactin (CTTN) in oral carcinoma and oral brushed samples from areca chewers.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19589785 2009 HER2 carboxyl-terminal fragments regulate cell migration and cortactin phosphorylation.
19457864 2009 Cortactin is a functional target of E-cadherin-activated Src family kinases in MCF7 epithelial monolayers.
19419567 2009 Distinct phosphorylation requirements regulate cortactin activation by TirEPEC and its binding to N-WASP.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19242064 2009 Expression of survivin and cortactin in colorectal adenocarcinoma: association with clinicopathological parameters.
19219613 2009 Expression of cortactin and survivin in renal cell carcinoma associated with tumor aggressiveness.
19207554 2009 Cortactin, fascin, and survivin expression associated with clinicopathological parameters in esophageal squamous cell carcinoma.
19146815 2009 Dynamic microtubules regulate dendritic spine morphology and synaptic plasticity.
18991334 2009 Distinctive clinicopathological associations of amplification of the cortactin gene at 11q13 in head and neck squamous cell carcinomas.
18931703 2009 Aggressiveness of HNSCC tumors depends on expression levels of cortactin, a gene in the 11q13 amplicon.
18776588 2008 Association of cortactin, fascin-1 and epidermal growth factor receptor (EGFR) expression in ovarian carcinomas: correlation with clinicopathological parameters.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18678675 2008 Cortactin recruitment by enterohemorrhagic Escherichia coli O157:H7 during infection in vitro and ex vivo.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18607838 2008 Overexpression of cortactin in head and neck squamous cell carcinomas can be uncoupled from augmented EGF receptor expression.
18521921 2008 A common cortactin gene variation confers differential susceptibility to severe asthma.
18406052 2008 Cortactin in tumor invasiveness.
18403644 2008 Hyperphosphorylated cortactin in cancer cells plays an inhibitory role in cell motility.
18387954 2008 PTP1B regulates cortactin tyrosine phosphorylation by targeting Tyr446.
18342393 2008 A new role for cortactin in invadopodia: regulation of protease secretion.
18334127 2008 [Expression and clinical significance of EMS1 gene in gastric carcinoma].
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
18039661 2008 Reversible tyrosine protein phosphorylation regulates large conductance voltage- and calcium-activated potassium channels via cortactin.
17959782 2007 An essential role for cortactin in the modulation of the potassium channel Kv1.2.
17702746 2007 CD44 regulates hepatocyte growth factor-mediated vascular integrity. Role of c-Met, Tiam1/Rac1, dynamin 2, and cortactin.
17643370 2007 HDAC6 modulates cell motility by altering the acetylation level of cortactin.
17627624 2007 Src, cortactin and Arp2/3 complex are required for E-cadherin-mediated internalization of Listeria into cells.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17576929 2007 p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin.
17562703 2007 Regulation of hyperoxia-induced NADPH oxidase activation in human lung endothelial cells by the actin cytoskeleton and cortactin.
17510372 2007 Association of cortactin and fascin-1 expression in gastric adenocarcinoma: correlation with clinicopathological parameters.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17483334 2007 Cortactin is an essential regulator of matrix metalloproteinase secretion and extracellular matrix degradation in invadopodia.
17451412 2007 Tyrosine phosphorylation controls cortactin binding to two enterohaemorrhagic Escherichia coli effectors: Tir and EspFu/TccP.
17449030 2007 Cortactin involvement in the keratinocyte growth factor and fibroblast growth factor 10 promotion of migration and cortical actin assembly in human keratinocytes.
17292556 2007 Roles of cortactin in tumor pathogenesis.
17255943 2007 CIN85, a Cbl-interacting protein, is a component of AMAP1-mediated breast cancer invasion machinery.
17178864 2006 Amplification and overexpression of CTTN (EMS1) contribute to the metastasis of esophageal squamous cell carcinoma by promoting cell migration and anoikis resistance.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17065230 2006 A noncanonical SH3 domain binding motif links BK channels to the actin cytoskeleton via the SH3 adapter cortactin.
17056576 2006 Endothelial cell cortactin coordinates intercellular adhesion molecule-1 clustering and actin cytoskeleton remodeling during polymorphonuclear leukocyte adhesion and transmigration.
17005439 2007 Amplifications of TAOS1 and EMS1 genes in oral carcinogenesis: association with clinicopathological features.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16937268 2006 Critical role of cortactin in actin ring formation and osteoclastic bone resorption.
16905744 2006 CXCL12 induces tyrosine phosphorylation of cortactin, which plays a role in CXC chemokine receptor 4-mediated extracellular signal-regulated kinase activation and chemotaxis.
16825658 2006 Endothelial cell barrier enhancement by ATP is mediated by the small GTPase Rac and cortactin.
16825425 2006 Cortactin phosphorylation sites mapped by mass spectrometry.
16815198 2006 Amplification of CCND1, EMS1, PIK3CA, and ERBB oncogenes in ethmoid sinus adenocarcinomas.
16652145 2006 Cortactin underpins CD44-promoted invasion and adhesion of breast cancer cells to bone marrow endothelial cells.
16636290 2006 Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
16611226 2006 Cortactin is essential for F-actin assembly in enteropathogenic Escherichia coli (EPEC)- and enterohaemorrhagic E. coli (EHEC)-induced pedestals and the alpha-helical region is involved in the localization of cortactin to bacterial attachment sites.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16527272 2006 Cortactin affects cell migration by regulating intercellular adhesion and cell spreading.
16489553 2006 A role for cortactin in Listeria monocytogenes invasion of NIH 3T3 cells, but not in its intracellular motility.
16442522 2006 Co-localization of cortactin and phosphotyrosine identifies active invadopodia in human breast cancer cells.
16416022 2006 Sphingosine-1-phosphate signaling regulates lamellipodia localization of cortactin complexes in endothelial cells.
16385081 2006 Endothelial cell cortactin phosphorylation by Src contributes to polymorphonuclear leukocyte transmigration in vitro.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16280034 2005 Cortactin overexpression results in sustained epidermal growth factor receptor signaling by preventing ligand-induced receptor degradation in human carcinoma cells.
16261345 2006 Dominant expression of 85-kDa form of cortactin in colorectal cancer.
16212419 Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC).
16076899 2005 Invasion of endothelial cells by Neisseria meningitidis requires cortactin recruitment by a phosphoinositide-3-kinase/Rac1 signalling pathway triggered by the lipo-oligosaccharide.
16051170 2005 Cortactin promotes cell motility by enhancing lamellipodial persistence.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15842855 2005 [Amplification of EMS1 gene in oral carcinogenesis].
15710041 2005 Comparative genome analysis of cortactin and HS1: the significance of the F-actin binding repeat domain.
15618548 2005 p47phox associates with the cytoskeleton through cortactin in human vascular smooth muscle cells: role in NAD(P)H oxidase regulation by angiotensin II.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15579908 2005 A neural Wiskott-Aldrich Syndrome protein-mediated pathway for localized activation of actin polymerization that is regulated by cortactin.
15574754 2004 Identification of a binding partner for the endothelial cell surface proteins TEM7 and TEM7R.
15561106 2005 The proto-oncogene Fgr regulates cell migration and this requires its plasma membrane localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464244 2004 Overexpression of cortactin is involved in motility and metastasis of hepatocellular carcinoma.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15263018 2004 Cortactin and Crk cooperate to trigger actin polymerization during Shigella invasion of epithelial cells.
15242766 2004 Interaction of cortactin and Arp2/3 complex is required for sphingosine-1-phosphate-induced endothelial cell remodeling.
15169891 2004 Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP.
15159385 2004 Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15123640 2004 Hyaluronan-CD44 interaction with Rac1-dependent protein kinase N-gamma promotes phospholipase Cgamma1 activation, Ca(2+) signaling, and cortactin-cytoskeleton function leading to keratinocyte adhesion and differentiation.
15064355 2004 BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.
15056655 2004 Pulmonary endothelial cell barrier enhancement by sphingosine 1-phosphate: roles for cortactin and myosin light chain kinase.
14742709 2004 RNAi-mediated Hip1R silencing results in stable association between the endocytic machinery and the actin assembly machinery.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13129922 2003 Cooperative roles of Fyn and cortactin in cell migration of metastatic murine melanoma.
12952985 2003 Alternative splicing of the actin binding domain of human cortactin affects cell migration.
12913069 2003 Fgd1, the Cdc42 GEF responsible for Faciogenital Dysplasia, directly interacts with cortactin and mAbp1 to modulate cell shape.
12835311 2003 Dual regulation of neuronal morphogenesis by a delta-catenin-cortactin complex and Rho.
12672817 2003 A Cortactin-CD2-associated protein (CD2AP) complex provides a novel link between epidermal growth factor receptor endocytosis and the actin cytoskeleton.
12620186 2003 Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453877 2002 Cdc42/Rac1-dependent activation of the p21-activated kinase (PAK) regulates human platelet lamellipodia spreading: implication of the cortical-actin binding protein cortactin.
12419186 2002 Dynamin2 and cortactin regulate actin assembly and filament organization.
12408982 2002 Novel interaction of cortactin with endothelial cell myosin light chain kinase.
12176742 2002 Osmotic stress-induced remodeling of the cortical cytoskeleton.
12176354 2002 Interaction of cortactin and N-WASp with Arp2/3 complex.
12151401 2002 Tyrosine phosphorylation of Kv1.2 modulates its interaction with the actin-binding protein cortactin.
12060669 2002 The Src-cortactin pathway is required for clustering of E-selectin and ICAM-1 in endothelial cells.
11988077 2002 Primary arrest of circulating platelets on collagen involves phosphorylation of Syk, cortactin and focal adhesion kinase: studies under flow conditions.
11830518 2002 Essential role of neural Wiskott-Aldrich syndrome protein in podosome formation and degradation of extracellular matrix in src-transformed fibroblasts.
11689006 2001 Caspase-mediated cleavage of actin-binding and SH3-domain-containing proteins cortactin, HS1, and HIP-55 during apoptosis.
11607842 2001 Cortactin: coupling membrane dynamics to cortical actin assembly.
11439336 2001 Hepatocyte Growth Factor/scatter factor-induces phosphorylation of cortactin in A431 cells in a Src kinase-independent manner.
11389697 2001 Thrombopoietin stimulates cortactin translocation to the cytoskeleton independently of tyrosine phosphorylation.
11018051 2000 Cortactin localization to sites of actin assembly in lamellipodia requires interactions with F-actin and the Arp2/3 complex.
10921917 2000 Cell volume-dependent phosphorylation of proteins of the cortical cytoskeleton and cell-cell contact sites. The role of Fyn and FER kinases.
10760273 2000 The polycystic kidney disease protein PKD2 interacts with Hax-1, a protein associated with the actin cytoskeleton.
10537323 1999 Signaling pathways and structural domains required for phosphorylation of EMS1/cortactin.
9823470 1998 Characterization of the EMS1 gene and its product, human Cortactin.
9813110 1998 Isolation and characterization of cortactin isoforms and a novel cortactin-binding protein, CBP90.
9792678 1998 Cortactin associates with the cell-cell junction protein ZO-1 in both Drosophila and mouse.
9748248 1998 The role of tyrosine phosphorylation of cortactin in the locomotion of endothelial cells.
9742101 1998 Identification of a novel cortactin SH3 domain-binding protein and its localization to growth cones of cultured neurons.
9722593 1998 Growth factor-dependent phosphorylation of the actin-binding protein cortactin is mediated by the cytoplasmic tyrosine kinase FER.
9553134 1998 Cortactin-Src kinase signaling pathway is involved in N-syndecan-dependent neurite outgrowth.
9054437 1997 The redistribution of cortactin into cell-matrix contact sites in human carcinoma cells with 11q13 amplification is associated with both overexpression and post-translational modification.
8636079 1996 Physical and functional association of cortactin with Syk in human leukemic cell line K562.
8474448 1993 The product of the EMS1 gene, amplified and overexpressed in human carcinomas, is homologous to a v-src substrate and is located in cell-substratum contact sites.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7685625 1993 Amplified region of chromosome band 11q13 in breast and squamous cell carcinomas encompasses three CpG islands telomeric of FGF3, including the expressed gene EMS1.
7680654 1993 Cortactin, an 80/85-kilodalton pp60src substrate, is a filamentous actin-binding protein enriched in the cell cortex.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
1532244 1992 Identification and cloning of two overexpressed genes, U21B31/PRAD1 and EMS1, within the amplified chromosome 11q13 region in human carcinomas.