Property Summary

NCBI Gene PubMed Count 39
PubMed Score 68.02
PubTator Score 56.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 3.100 1.5e-04
interstitial lung disease -1.200 4.2e-02
Multiple myeloma 1.174 8.4e-03
malignant mesothelioma -1.700 3.9e-07
oligodendroglioma -1.200 1.9e-02
permanent atrial fibrillation -1.300 3.7e-02
esophageal adenocarcinoma 1.500 2.8e-02
osteosarcoma -2.568 1.7e-05
glioblastoma 1.300 2.9e-02
atypical teratoid / rhabdoid tumor -1.900 1.6e-02
medulloblastoma, large-cell -3.100 2.0e-06
tuberculosis 1.200 2.4e-06
diabetes mellitus -1.300 1.2e-02
interstitial cystitis 1.400 2.8e-03
subependymal giant cell astrocytoma 1.729 1.5e-02
invasive ductal carcinoma 1.907 2.7e-04
lung carcinoma -1.700 2.3e-23
gastric carcinoma 1.400 2.0e-02
ovarian cancer 1.500 2.0e-04

Gene RIF (20)

PMID Text
25442015 Cathepsin X (CTSX) is involved in early tumorigenesis and in the stabilization of tumor cell formation in colorectal cancer.
25433997 Down-regulation of RPLP0 resulted in G1 arrest of gastric cancer cells, whereas knockdown of Cathepsin X led to G1 arrest and apoptosis
24725597 The significant association of cathepsin X with survival in a group of patients who received no chemotherapy and the absence of this association in the group who received chemotherapy, suggest the possible predictive value for response to chemotherapy.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cathepsin Z (CTSZ) expression by HIV-1 Vpr in Vpr transduced macrophages
23827504 Suggest CTSZ rs34069356 polymorphism is not associated with pulmonary tuberculosis in a sample Iranian population.
22632162 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cathepsin Z (CTSZ) expression by HIV-1 Vpr in Vpr transduced macrophages
22451661 Cathepsins L and Z are critical in degrading polyglutamine-containing proteins within lysosomes.
21966391 cathepsin Z contributes to tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma
21616554 cathepsin X deficiency leads to accelerated cellular senescence and consequently to diminished cellular proliferation and migration/invasion implying a potential role of cathepsin X in bypassing cellular senescence.
21454358 We show that sequential cleavage of C-terminal amino acids from the beta(2) cytoplasmic tail of LFA-1, by CatX, enhances binding of the adaptor protein talin to LFA-1 and triggers formation of the latter's high-affinity form
21368909 Polymorphisms in MC3R promoter and CTSZ 3'UTR are associated with tuberculosis susceptibility.
21354459 associated with tuberculosis in a Ugandan household contact study
21310951 Cysteine proteases bleomycin hydrolase and cathepsin Z mediate N-terminal proteolysis and toxicity of mutant huntingtin.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of cathepsin Z (CTSZ) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18420963 unlikely that CTSZ gene plays a major role in tuberculosis susceptibility in African populations
18420963 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17065156 the extracellular function of cathepsin X may include binding to integrins thereby modulating the attachment of migrating cells to ECM components [Cathepsin X]
15680921 These results show that cathepsin P, in contrast to other mammalian cathepsins, has a restricted catalytic specificity.

AA Sequence

MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN      1 - 70
VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV     71 - 140
WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG    141 - 210
PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY    211 - 280
KDGKGARYNLAIEEHCTFGDPIV                                                   281 - 303
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25442015 2014 Characterization of cathepsin X in colorectal cancer development and progression.
25433997 2015 Dysregulation of apoptotic signaling pathways by interaction of RPLP0 and cathepsin X/Z in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24725597 2014 Prognostic and predictive value of cathepsin X in serum from colorectal cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23827504 2013 Association of CTSZ rs34069356 and MC3R rs6127698 gene polymorphisms with pulmonary tuberculosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22451661 2012 Cathepsins L and Z are critical in degrading polyglutamine-containing proteins within lysosomes.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21966391 2011 Overexpression of cathepsin Z contributes to tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma.
21616554 2011 Cellular senescence induced by cathepsin X downregulation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21454358 2011 Cathepsin X cleavage of the beta2 integrin regulates talin-binding and LFA-1 affinity in T cells.
21368909 2011 Polymorphisms in MC3R promoter and CTSZ 3'UTR are associated with tuberculosis susceptibility.
21354459 2011 Genetic susceptibility to tuberculosis associated with cathepsin Z haplotype in a Ugandan household contact study.
21310951 2011 Cysteine proteases bleomycin hydrolase and cathepsin Z mediate N-terminal proteolysis and toxicity of mutant huntingtin.
21269460 2011 Initial characterization of the human central proteome.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18420963 2008 Mapping of a novel susceptibility locus suggests a role for MC3R and CTSZ in human tuberculosis.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17065156 2006 RGD-dependent binding of procathepsin X to integrin alphavbeta3 mediates cell-adhesive properties.
16381901 2006 The LIFEdb database in 2006.
15680921 2005 Defining the substrate specificity of mouse cathepsin P.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11030415 2000 Characterization of TH1 and CTSZ, two non-imprinted genes downstream of GNAS1 in chromosome 20q13.
10760573 2000 Murine and human cathepsin Z: cDNA-cloning, characterization of the genes and chromosomal localization.
10745011 2000 Crystal structure of cathepsin X: a flip-flop of the ring of His23 allows carboxy-monopeptidase and carboxy-dipeptidase activity of the protease.
10656802 2000 Crystal structure of human procathepsin X: a cysteine protease with the proregion covalently linked to the active site cysteine.
10653163 2000 Tissue expression and immunolocalization of a novel human cathepsin P.
10653162 2000 Identification and molecular cloning of cathepsin P, a novel human putative cysteine protease of the papain family.
10504234 1999 Human cathepsin X: A cysteine protease with unique carboxypeptidase activity.
9738465 1998 Human cathepsin X: a novel cysteine protease of the papain family with a very short proregion and unique insertions.
9642240 1998 Cathepsin Z, a novel human cysteine proteinase with a short propeptide domain and a unique chromosomal location.