Property Summary

Ligand Count 2
NCBI Gene PubMed Count 40
PubMed Score 70.19
PubTator Score 56.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.900 1.6e-02
diabetes mellitus -1.300 1.2e-02
esophageal adenocarcinoma 1.500 2.8e-02
gastric carcinoma 1.400 2.0e-02
glioblastoma 1.300 2.9e-02
interstitial cystitis 1.400 2.8e-03
interstitial lung disease -1.200 4.2e-02
invasive ductal carcinoma 1.907 2.7e-04
lung carcinoma -1.700 2.3e-23
malignant mesothelioma -1.700 3.9e-07
medulloblastoma, large-cell -3.100 2.0e-06
Multiple myeloma 1.174 8.4e-03
oligodendroglioma -1.200 1.9e-02
osteosarcoma -2.568 1.7e-05
ovarian cancer 1.500 2.0e-04
permanent atrial fibrillation -1.300 3.7e-02
Rheumatoid arthritis 3.100 1.5e-04
subependymal giant cell astrocytoma 1.729 1.5e-02
tuberculosis 1.200 2.4e-06

Gene RIF (20)

AA Sequence

MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN      1 - 70
VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV     71 - 140
WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG    141 - 210
PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY    211 - 280
KDGKGARYNLAIEEHCTFGDPIV                                                   281 - 303
//

Text Mined References (46)

PMID Year Title