| Tbio | Cathepsin W |
May have a specific function in the mechanism or regulation of T-cell cytolytic activity.
The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene is up-regulated by interleukin-2. [provided by RefSeq, Jul 2008]
The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene is up-regulated by interleukin-2. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 1.1e-17 |
| lung carcinoma | 2844 | 5.7e-10 |
| osteosarcoma | 7933 | 7.1e-06 |
| tuberculosis | 1563 | 3.5e-05 |
| cutaneous lupus erythematosus | 1056 | 5.0e-03 |
| acute myeloid leukemia | 785 | 2.6e-02 |
| Disease | log2 FC | p |
|---|---|---|
| cutaneous lupus erythematosus | 1.900 | 5.0e-03 |
| osteosarcoma | -3.716 | 7.1e-06 |
| tuberculosis | 1.100 | 3.5e-05 |
| non-small cell lung cancer | -1.320 | 1.1e-17 |
| lung carcinoma | -1.400 | 5.7e-10 |
| acute myeloid leukemia | 1.600 | 2.6e-02 |
| PMID | Text | |
|---|---|---|
| 26060270 | These results establish CtsW as an important host factor for entry of influenza A virus into target cells and suggest that CtsW could be a promising target for the development of future antiviral drugs. | |
| 22050231 | The predominant expression of wildtype form by infiltrating immune cells was confirmed in 116 patients with gastroesophageal reflux disease and 27 reflux-negative individuals demonstrating that cathepsin W expression is not altered in this disease. | |
| 19100676 | Despite being expressed in the effector subset of CD8(+) and NK cells and of being released during target cell killing, our functional inhibition studies exclude an essential role of CatW in the process of cytotoxicity. | |
| 15358123 | a genetic variant and a novel isoform of cathepsin W are present in about 14% and 12%, respectively, within the Caucasian population | |
| 12437118 | Cathepsin W-positive cells had a 'lymphocyte phenotype', but the relative portion of cathepsin W-positive cells among the infiltrating leukocytes in gastrointestinal disease differed remarkably. | |
| 11490002 | Endogenous cathepsin W is expressed predominantly in NK cells, is up-regulated by IL-2, and is mainly targeted to the endoplasmic reticulum. |
MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNL 1 - 70 AQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASA 71 - 140 ISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLA 141 - 210 SEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKAT 211 - 280 PTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSN 281 - 350 TCGITKFPLTARVQKPDMKPRVSCPP 351 - 376 //
| PMID | Year | Title | |
|---|---|---|---|
| 26060270 | 2015 | Cathepsin W Is Required for Escape of Influenza A Virus from Late Endosomes. | |
| 24927181 | 2014 | Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris. | |
| 23128233 | 2012 | Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease. | |
| 22050231 | 2011 | Expression pattern of cathepsin W isoforms in peripheral blood and gastroesophageal mucosa of patients with gastroesophageal reflux disease. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 19100676 | 2009 | Cathepsin W expressed exclusively in CD8+ T cells and NK cells, is secreted during target cell killing but is not essential for cytotoxicity in human CTLs. | |
| 16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15358123 | 2004 | Identification of a novel isoform predominantly expressed in gastric tissue and a triple-base pair polymorphism of the cathepsin W gene. | |
| 15340161 | 2004 | Signal peptide prediction based on analysis of experimentally verified cleavage sites. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12437118 | Characterization of novel anti-cathepsin W antibodies and cellular distribution of cathepsin W in the gastrointestinal tract. | ||
| 11490002 | 2001 | Human cathepsin W, a cysteine protease predominantly expressed in NK cells, is mainly localized in the endoplasmic reticulum. | |
| 10849754 | 2000 | Human cathepsins W and F form a new subgroup of cathepsins that is evolutionary separated from the cathepsin B- and L-like cysteine proteases. | |
| 10716634 | 2000 | Phylogenetic relationships and theoretical model of human cathepsin W (lymphopain), a cysteine proteinase from cytotoxic T lymphocytes. | |
| 10362521 | 1999 | Human cathepsins F and W: A new subgroup of cathepsins. | |
| 9823953 | 1998 | Lymphopain, a cytotoxic T and natural killer cell-associated cysteine proteinase. | |
| 9675123 | 1998 | Genomic structure, chromosomal localization, and expression of human cathepsin W. | |
| 9108299 | 1997 | Human cathepsin W, a putative cysteine protease predominantly expressed in CD8+ T-lymphocytes. |
