Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.69
PubTator Score 19.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 5.0e-03
osteosarcoma -3.716 7.1e-06
tuberculosis 1.100 3.5e-05
non-small cell lung cancer -1.320 1.1e-17
lung carcinoma -1.400 5.7e-10
acute myeloid leukemia 1.600 2.6e-02

Gene RIF (6)

PMID Text
26060270 These results establish CtsW as an important host factor for entry of influenza A virus into target cells and suggest that CtsW could be a promising target for the development of future antiviral drugs.
22050231 The predominant expression of wildtype form by infiltrating immune cells was confirmed in 116 patients with gastroesophageal reflux disease and 27 reflux-negative individuals demonstrating that cathepsin W expression is not altered in this disease.
19100676 Despite being expressed in the effector subset of CD8(+) and NK cells and of being released during target cell killing, our functional inhibition studies exclude an essential role of CatW in the process of cytotoxicity.
15358123 a genetic variant and a novel isoform of cathepsin W are present in about 14% and 12%, respectively, within the Caucasian population
12437118 Cathepsin W-positive cells had a 'lymphocyte phenotype', but the relative portion of cathepsin W-positive cells among the infiltrating leukocytes in gastrointestinal disease differed remarkably.
11490002 Endogenous cathepsin W is expressed predominantly in NK cells, is up-regulated by IL-2, and is mainly targeted to the endoplasmic reticulum.

AA Sequence

MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNL      1 - 70
AQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASA     71 - 140
ISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLA    141 - 210
SEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKAT    211 - 280
PTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSN    281 - 350
TCGITKFPLTARVQKPDMKPRVSCPP                                                351 - 376
//

Text Mined References (19)

PMID Year Title
26060270 2015 Cathepsin W Is Required for Escape of Influenza A Virus from Late Endosomes.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22050231 2011 Expression pattern of cathepsin W isoforms in peripheral blood and gastroesophageal mucosa of patients with gastroesophageal reflux disease.
19946888 2010 Defining the membrane proteome of NK cells.
19100676 2009 Cathepsin W expressed exclusively in CD8+ T cells and NK cells, is secreted during target cell killing but is not essential for cytotoxicity in human CTLs.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358123 2004 Identification of a novel isoform predominantly expressed in gastric tissue and a triple-base pair polymorphism of the cathepsin W gene.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437118 Characterization of novel anti-cathepsin W antibodies and cellular distribution of cathepsin W in the gastrointestinal tract.
11490002 2001 Human cathepsin W, a cysteine protease predominantly expressed in NK cells, is mainly localized in the endoplasmic reticulum.
10849754 2000 Human cathepsins W and F form a new subgroup of cathepsins that is evolutionary separated from the cathepsin B- and L-like cysteine proteases.
10716634 2000 Phylogenetic relationships and theoretical model of human cathepsin W (lymphopain), a cysteine proteinase from cytotoxic T lymphocytes.
10362521 1999 Human cathepsins F and W: A new subgroup of cathepsins.
9823953 1998 Lymphopain, a cytotoxic T and natural killer cell-associated cysteine proteinase.
9675123 1998 Genomic structure, chromosomal localization, and expression of human cathepsin W.
9108299 1997 Human cathepsin W, a putative cysteine protease predominantly expressed in CD8+ T-lymphocytes.