Property Summary

NCBI Gene PubMed Count 136
PubMed Score 1955.91
PubTator Score 198.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Contact Dermatitis 77
Disease Target Count
Chronic hepatitis C 12
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

  Differential Expression (30)

Disease log2 FC p
active Crohn's disease 1.123 5.7e-03
adult high grade glioma 2.200 2.9e-03
Astrocytoma, Pilocytic 2.000 8.6e-05
Barrett's esophagus 1.100 2.4e-02
colon cancer -1.200 9.3e-05
cutaneous lupus erythematosus 2.500 6.3e-03
cystic fibrosis 1.100 3.4e-03
diabetes mellitus -1.700 2.8e-02
esophageal adenocarcinoma 1.700 1.8e-02
glioblastoma 1.600 8.3e-04
interstitial cystitis 1.200 1.7e-02
intraductal papillary-mucinous adenoma (... 2.000 1.5e-03
intraductal papillary-mucinous neoplasm ... 2.100 9.7e-03
invasive ductal carcinoma 1.290 5.4e-03
juvenile dermatomyositis 1.092 7.0e-06
lung cancer -2.100 5.8e-04
lung carcinoma -3.600 5.8e-33
mucosa-associated lymphoid tissue lympho... 1.380 3.1e-02
Multiple myeloma 1.787 1.9e-04
nephrosclerosis 1.049 1.7e-02
non-small cell lung cancer -1.436 4.7e-13
osteosarcoma -2.112 2.2e-03
ovarian cancer -2.200 2.5e-06
pancreatic cancer 1.100 6.4e-03
periodontitis 1.100 2.0e-21
posterior fossa group A ependymoma 1.100 8.5e-03
primary Sjogren syndrome 1.700 2.9e-05
Rheumatoid arthritis 1.400 8.6e-03
subependymal giant cell astrocytoma 2.306 4.4e-02
tuberculosis 1.300 1.3e-06

Gene RIF (100)

AA Sequence

MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGM      1 - 70
HSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACW     71 - 140
AFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMD    141 - 210
QKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGV    211 - 280
LVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI                       281 - 331
//

Text Mined References (141)

PMID Year Title