Property Summary

NCBI Gene PubMed Count 206
PubMed Score 2387.30
PubTator Score 678.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.300 5.1e-05
cutaneous lupus erythematosus 1.800 2.4e-03
dermatomyositis 1.100 2.7e-02
gastric carcinoma 1.200 4.2e-02
glioblastoma 1.700 1.4e-03
lung carcinoma -1.300 6.9e-15
medulloblastoma, large-cell -1.200 8.3e-05
Multiple Sclerosis 1.300 3.5e-02
ovarian cancer -2.000 1.0e-07
pancreatic ductal adenocarcinoma liver m... -1.606 3.7e-03
psoriasis 2.000 7.1e-05
tuberculosis -3.100 1.1e-05

Protein-protein Interaction (5)

Gene RIF (145)

AA Sequence

MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGK      1 - 70
HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA     71 - 140
FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES    141 - 210
CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV    211 - 280
VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV                     281 - 333
//

Text Mined References (212)

PMID Year Title