Property Summary

NCBI Gene PubMed Count 144
PubMed Score 869.69
PubTator Score 658.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
glioblastoma 1.400 3.4e-02
osteosarcoma 2.102 3.7e-02
medulloblastoma 1.400 4.4e-05
cystic fibrosis 1.888 2.2e-06
Duchenne muscular dystrophy 1.551 6.4e-11
acute quadriplegic myopathy 1.266 6.2e-05
Atopic dermatitis -1.800 1.4e-03
tuberculosis and treatment for 6 months 1.300 3.0e-04
primary pancreatic ductal adenocarcinoma 3.454 3.1e-05
intraductal papillary-mucinous adenoma (... -1.700 1.1e-02
intraductal papillary-mucinous carcinoma... -1.500 3.6e-02
pancreatic cancer 3.400 4.0e-05
diabetes mellitus -1.300 6.3e-03
adult high grade glioma 1.100 1.2e-03
pilocytic astrocytoma 2.300 9.1e-09
primary Sjogren syndrome 1.300 6.7e-04
Breast cancer 1.700 2.4e-06
gastric carcinoma 2.400 2.8e-03
ulcerative colitis 2.500 2.9e-05
ovarian cancer -2.200 8.5e-05

Protein-protein Interaction (10)

Gene RIF (112)

PMID Text
26302400 elevated levels of CatK are closely associated with the presence of chronic heart failure and that the measurement of circulating CatK provides a noninvasive method of documenting and monitoring the extent of chronic heart failure
26241216 increased expression and activation in osteoarthritis cartilage
26219353 Matrix-metalloproteinase-9 is cleaved and activated by cathepsin K.
25809793 SDF-1alpha is involved in homing of CXCR4+ GSLCs and leukocytes and that cathepsin K and osteopontin are involved in the migration of GSLCs out of the niches
25725806 Sequence analysis of the patient's CTSK gene revealed homozygosity for a missense mutation (c.746T>C) in exon 6, which leads to amino change (p.Ile249Thr) in the mature CTSK protein
25662720 There is an increase in levels of CATK in type 1 Gaucher patients compared to the control group. In the patient group, CATK showed higher levels in patients with bone damage compared to those without it.
25626674 The study determined almost identical substrate specificities for cysteine cathepsins K, L and S.
25558848 Cathepsins in Rotator Cuff Tendinopathy: Identification in Human Chronic Tears and Temporal Induction in a Rat Model.
25422423 one cathepsin K molecule binds to collagen-bound glycosaminoglycans at the gap region and recruits a second protease molecule that provides an unfolding and cleavage mechanism for triple helical collagen
25356585 The presence of high levels of inactive proforms of cathepsin K in GBM tissues and cells indicate that in GBM the proteolytic/collagenolytic role is not its primary function but it plays rather a different yet unknown role.
25279554 The identification of CatK exosites opens up the prospect of designing highly potent inhibitors that selectively inhibit the degradation of therapeutically relevant substrates by this multifunctional protease.
25184245 Two compounds have sizable effects on enzyme activity using interstitial collagen as a natural substrate of cathepsin K and four compounds show a significantly stabilizing effect on cathepsin K.
24958728 results demonstrate that CS plays an important role in contributing to the enhanced efficiency of CatK collagenase activity in vivo
24954318 The data indicated that elevated levels of cathepsin K are closely associated with the presence of CAD and that circulating cathepsin K serves a useful biomarker for CAD.
24835450 Studies indicate cathepsin X as a target for improving diagnosis and treating cancer patients.
24767306 identified five CTSK missense mutations (M1I, I249T, L7P, D80Y and D169N), one nonsense mutation (R312X) and one 301 bp insertion in intron 7, which is revealed as Alu sequence; among them, only L7P and I249 were described previously
24719048 synergism between HIV proteins and pro-atherogenic shear stress to increase endothelial cell expression of the powerful protease cathepsin K
24719048 Co-stimulation with pro-atherogenic shear stress and HIV-1 Tat upregulates cathepsin K and V activity in human aortic endothelial cells
24696729 Cathepsin K appears to be consistently and strongly expressed in melanocytic lesions and valuable in distinguishing malignant melanomas from the majority of human cancers.
24583396 catalase expression (or activity) was higher, while intracellular and extracellular Cat S, Cat L, and Cat K activities were lower in the non-invasive CL1-0 cells compared to the highly invasive CL1-5 cells.
24342995 Increased plasma CatK levels are linked with the presence of atrial fibrillation.
24269275 The use of exome sequencing in the molecular diagnosis of 2 siblings initially thought to be affected by "intermediate osteopetrosis", which identified a homozygous mutation in the CTSK gene, is described.
24134756 Skipping of the 121-bp exon 2 results in elimination of the normal start codon and an expected absence of the wild-type CTSK protein.
24088021 The basic amino acid clusters in cathepsin K play roles in the formation of collagenolytically active protease complexes.
23951042 Data indicate that cathepsin K is expressed in oral tongue squamous cell carcinoma (OTSCC) tissue in both carcinoma and tumor microenvironment (TME) cells.
23871919 Expression of cathepsins K, S and V within keratinocytes is reduced in photoprotected skin of aged women.
23689398 Identification of a novel insertional frameshift mutation in exon 4 of the CTSK gene in two families with pycnodysostosis.
23529168 Cardiac mammalian target of rapamycin and extracellular signal-regulated kinases (ERK) signaling cascades were upregulated by pressure overload, the effects of which were attenuated by cathepsin K knockout.
23483898 Quantification of immunohistochemistry showed that there is no difference in the global expression of CTSD, CTSH and CTSK between asthmatics and non-asthmatics.
23369704 These data indicated that high levels of CatK are closely linked with the presence of coronary artery disease.
23355199 Cathepsin K immunohistochemistry can be helpful in distinguishing alveolar soft part sarcomas and translocation renal cell carcinomas from some but not all of the lesions in their differential diagnosis.
23326535 Our results demonstrate that increased adhesion, migration and invasiveness of tumor cells depend on the inactivation of the tumor suppressive function of profilin 1 by cathepsin X.
23152410 Cathepsin X deficiency leads to a reduced phosphorylation of the IGF-I receptor in response to IGF-I stimulation.
22974233 Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K.
22730330 Cathepsin S cannibalism of cathepsin K as a mechanism to reduce type I collagen degradation.
22614014 show for the first time that bone marrow macrophage-supplied CTSK may be involved in CCL2- and COX-2-driven pathways that contribute to tumor progression in bone
22569910 the collagenolytic activity of cathepsin K may be increased toward more matured bone collagen.
22569264 Data suggest that clusterin increases stability of cathepsin K in dilute/concentrated solutions; clusterin prevents substrate inhibition of cathepsin K; kinetic measurements show that clusterin binds cathepsin K with high affinity.
22562303 inflammatory cues and monocyte-endothelial cell interactions upregulate cathepsin K and V activity via a JNK signaling axis
21880134 Cathepsin K gene expression was found to be significantly greater in more degenerated compared to healthier discs
21874011 Cathepsin K was found to be constantly and strongly expressed in renal PEComas.
21756348 Cathepsins K, L, and S activity are profiled in 10 mug human breast, lung, and cervical tumors.
21715684 Cathepsin K- and L-cleaved chemerin trigger robust migration of human blood-derived plasmacytoid dendritic cells ex vivo
21602817 Demonstrate here the differential expression of cathepsin K among neoplasms harboring TFE3 gene fusions.
21099701 The novel homozygous mutation c.908G>A within exon 8 of the CTSK gene, was identified.
21086906 Cath-K represents a sensitive and specific marker to detect and quantitate granulomatous reactions in interstitial lung diseases, and is particularly useful in chronic hypersensitivity pneumonitis cases.
20869948 Co-stimulation with pro-atherogenic shear stress and HIV-1 Tat upregulates cathepsin K and V activity in human aortic endothelial cells
20837372 serum levels and catios of catK and catL to cysC were not significantly different between patients with coronary artery ectasia and controls
20727023 a constant and strong expression of cathepsin K in dermatofibroma, but its complete absence in dermatofibrosarcoma protuberans
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20494937 The exo-peptidase cathepsin X has been identified as a new member of the group of CXCL-12-degrading enzymes secreted by non-hematopoietic bone marrow cells. Cathepsin X can influence hematopoietic stem and progenitor cell trafficking in the bone marrow.
20450492 identify and characterize sulfated glycosaminoglycans as natural allosteric modifiers of cathepsin K that exploit the conformational flexibility of the enzyme to regulate its activity and stability against autoproteolysis
20430722 Results suggest a role for syndecan-1 and cathepsins D and K in growth and invasiveness of esophageal squamous cell carcinoma.
20305575 A novel missense mutation was identified in CTSK gene in a Pakistani family with 5 individuals affected with autosomal recessive pycnodysostosis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19886543 Cathepsin-k appears to be a reliable tool for the precise and rapid identification of small epithelioid granulomas in Crohn's disease.
19800993 cleaves kinins and converts angiotensin I to angiotensin II thuys generating hormone peptide receptor agonists
19750481 Gradual cleavage of LFA-1 by cathepsin X enables the transition between intermediate and high affinity LFA-1
19700761 role of bone marrow cathepsin K in regulation of biological activity of SPARC in bone metastasis
19674475 Our study strengthens the role of a missense mutation in the CTSK gene in the pathogenesis of pycnodysostosis and suggests its prevalence in Pakistani patients
19469903 Skin fibroblasts were found to strongly express catK in lysosomes.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19446361 Cathepsin X prevents an effective immune response against Helicobacter pylori infection. Cathepsin X mediated activation of Mac-1 suppresses the stimulatory signal in the form of cytokines.
19433310 Isozymes alpha- and gamma-enolases were identified as targets for cathepsin X.
19428782 cathepsin K might significantly contribute to altered opioid levels in brains of schizophrenics
19396149 Cathepsin-K immunolabeling in both TFE3 and TFEB translocation renal cell carcinomas distinguishes these neoplasms from the more common adult renal cell carcinomas
19371798 Observational study of gene-disease association. (HuGE Navigator)
19338743 In this review, some of the known features of cathepsin K such as structure, function in bone resorption, gene regulation and its roles in physiological or pathophysiological processes are highlighted.
19194656 Cathepsin X-upregulated T cells exhibit increased homotypic aggregation and polarized, migration-associated morphology in 2D and 3D models. Extended uropods are frequently formed, which subsequently elongate to nanotubes connecting T lymphocytes
19060845 Rerpot cathepsin-k expression in pulmonary lymphangioleiomyomatosis.
18979635 incomplete inactivation may partially explain why active cysteine cathepsins are still found during acute lung inflammation
18949742 cathepsin B, cathepsin H, cathepsin X and cystatin C may have roles in inflammatory breast cancer
18765527 CTSK may function as a paracrine factor in breast tumorigenesis.
18692071 crystal structure of a 1:n complex of cathepsin K:chondroitin 4-sulfate
18664521 Comparison of the S2 site between rat and human cathepsin K sequences indicated that two S2 residues at Ser134 and Val160 in rat are varied to Ala and Leu, respectively, in the human enzyme.
18664495 Cathepsin X causes cytoskeletal rearrangements and stimulates migration of T lymphocytes.
18511517 cathepsin K is involved in the cleavage of type II collagen in human articular cartilage in certain OA patients and that it may play a role in both OA pathophysiology and the aging process.
18368130 catK may play an important role in melanoma invasion and metastasis by mediating intracellular degradation of matrix proteins after phagocytosis
18163891 did not detect any plasminogen degradation by cathepsins B, K and L.
18053985 Myeloma-osteoclast interactions stimulated the production of TRAP, cathepsin K, MMP-1, -9, and uPA
17991740 Induction of cathepsin K is associated with the activation of protein p38 MAP kinase.
17882010 in peri-and postmenopausal women, moderate negative correlation of serum cathepsin K levels with change in femoral neck BMD, but none with change in spinal BMD was found
17728092 In breast cancer patients, cathepsin K serum levels were significantly lower than in sex matched control group or in patients with primary osteoporosis
17683065 Cathepsin K expression is of predictive prognostic value for patients with high-grade osteosaromas and metastasis at diagnosis.
17397052 molecular characterization of 12 unrelated patients with Pycnodysostosis; mutational profile consisted of 12 different mutations, including nine previously unreported ones
17230547 Cathepsin K is constitutively expressed in normal human brain, and is alterated in its expression inscizophrenia.
17227755 analysis of human cathepsins K, L, and S iunteractions with elastins
16946716 Possiable role in homeostasis of dermal extracellular matrix and dynamic equilibrium between matrix synthesis and proteolytic degradation, by counteracting deposition of matrix proteins during scar formation with its matrix-degrading activity.
16912123 CTSK may be involved in the pathogenesis of obesity by promoting adipocyte differentiation.
16831915 Cathepsin K is essential for normal bone resorption (review)
16774752 Active cathepsin X mediates the function of beta(2) integrin receptors during cell adhesion and that it could also be involved in other processes associated with beta(2) integrin receptors such as phagocytosis and T cell activation.
16354158 The presence of active cathepsins L, K and S suggests that they contribute to the extracellular breakdown of the extracellular matrix.
16337236 Osteoblastic cathepsin K may thus contribute to collagenous matrix maintenance and recycling of improperly processed collagen I
15929988 Cathepsin K co-localized with TRAP in osteoclast-resorptive compartments, supporting a role for cathepsin K in the extracellular processing of monomeric TRAP in the resorption lacuna.
15878337 Cathepsin X is not involved in degradation of extracellular matrix, a proteolytic event leading to tumor cell invasion and metastasis, and its expression, restricted to immune cells suggests a role in phagocytosis and the regulation of immune response.
15837295 Several novel ketoamide-based inhibitors of cathepsin K have been identified.
15826870 results support the role of cathepsin K as a major proteinase in osteoclastic bone resorption
15797245 heparan sulfate proteoglycans can regulate the cellular trafficking and the enzymatic activity of cathepsin X
15737607 These findings suggest that a specific function of human cathepsin X is unlikely to result from sequence specificity, but rather from a combination of its unique positional specificity and the co-localization of enzyme and substrate.
15304486 RANKL-induced cathepsin K gene expression is cooperatively regulated by the combination of the transcription factors and p38 MAP kinase in a gradual manner.
15161653 Cathepsin K plays a pivotal role in lung matrix homeostasis under physiological and pathological conditions.
14753734 Observational study of gene-disease association. (HuGE Navigator)
14645229 cathepsin K has a role in lysosomal collagenolytic activity
12887056 cathepsin K is capable to degrade aggrecan complexes at specific cleavage sites
12652657 In db/db mice, cathepsin k(ctsk) increased, as did Mitf and TFE3, two transcription factors involved in ctsk induction in osteoclasts. Ctsk was increased in other obese models including A(y), fat, and tubby.
12568399 cathepsin K may have a role in contributing to the invasive potential of prostate cancer
12492488 data suggest that extracellular cysteine proteases may participate in the regulation of kinin levels at inflammatory sites, and clearly support that cathepsin K may act as a potent kininase
12125807 review discusses the human disease pycnodysostosis caused by cathepsin K deficiency and cathepsin K activity and regulation
12081494 Selective inhibition of the collagenolytic activity by altering its S2 subsite specificity
12039963 cathepsin K binds with chondroitin sulfate for collagenase activity
11733367 This study demonstrates for the first time a critical role of Cathepsin K in cartilage degradation by synovial fibroblasts (SFs) in rheumatoid arthritis (RA) that is comparable to its well-known activity in osteoclasts.

AA Sequence

MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHT      1 - 70
YELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCW     71 - 140
AFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESC    141 - 210
MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLA    211 - 280
VGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM                         281 - 329
//

Text Mined References (147)

PMID Year Title
26302400 2015 Increased Circulating Cathepsin K in Patients with Chronic Heart Failure.
26241216 2016 Increased expression and activation of cathepsin K in human osteoarthritic cartilage and synovial tissues.
26219353 2015 Matrix-metalloproteinase-9 is cleaved and activated by cathepsin K.
25809793 2015 CD133+ and Nestin+ Glioma Stem-Like Cells Reside Around CD31+ Arterioles in Niches that Express SDF-1?, CXCR4, Osteopontin and Cathepsin K.
25731711 2015 Dental Abnormalities Caused by Novel Compound Heterozygous CTSK Mutations.
25725806 2015 A Mutation in CTSK Gene in an Autosomal Recessive Pycnodysostosis Family of Chinese Origin.
25662720 2015 [Cathepsin K as a biomarker of bone involvement in type 1 Gaucher disease].
25626674 2015 Fast profiling of protease specificity reveals similar substrate specificities for cathepsins K, L and S.
25558848 2015 Cathepsins in Rotator Cuff Tendinopathy: Identification in Human Chronic Tears and Temporal Induction in a Rat Model.
25422423 2014 Structural basis of collagen fiber degradation by cathepsin K.
25356585 2014 Expression analysis of all protease genes reveals cathepsin K to be overexpressed in glioblastoma.
25279554 2015 Structural requirements for the collagenase and elastase activity of cathepsin K and its selective inhibition by an exosite inhibitor.
25184245 2014 Probing the activity modification space of the cysteine peptidase cathepsin K with novel allosteric modifiers.
24958728 2014 Chondroitin sulfate promotes activation of cathepsin K.
24954318 2014 Increased serum cathepsin K in patients with coronary artery disease.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24835450 2015 Intracellular signaling by cathepsin X: molecular mechanisms and diagnostic and therapeutic opportunities in cancer.
24767306 2014 Cathepsin K analysis in a pycnodysostosis cohort: demographic, genotypic and phenotypic features.
24719048 2014 Pro-atherogenic shear stress and HIV proteins synergistically upregulate cathepsin K in endothelial cells.
24696729 2014 Cathepsin K in the immunohistochemical diagnosis of melanocytic lesions.
24583396 2014 The effect of catalase on migration and invasion of lung cancer cells by regulating the activities of cathepsin S, L, and K.
24342995 2013 Mechanisms with clinical implications for atrial fibrillation-associated remodeling: cathepsin K expression, regulation, and therapeutic target and biomarker.
24269275 2014 Exome sequencing identifies CTSK mutations in patients originally diagnosed as intermediate osteopetrosis.
24134756 2013 Novel CTSK mutation resulting in an entire exon 2 skipping in a Thai girl with pycnodysostosis.
24088021 2013 The role of basic amino acid surface clusters on the collagenase activity of cathepsin K.
23951042 2013 Cathepsin K is present in invasive oral tongue squamous cell carcinoma in vivo and in vitro.
23871919 2014 Differential expression of cathepsins K, S and V between young and aged Caucasian women skin epidermis.
23689398 2013 A novel mutation in two families with pycnodysostosis.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23529168 2013 Cathepsin K knockout alleviates pressure overload-induced cardiac hypertrophy.
23483898 2013 The expression and activity of cathepsins D, H and K in asthmatic airways.
23369704 2013 Circulating cathepsin K as a potential novel biomarker of coronary artery disease.
23355199 2013 A broad survey of cathepsin K immunoreactivity in human neoplasms.
23326535 2013 Profilin 1 as a target for cathepsin X activity in tumor cells.
23152410 2012 IGF-I receptor phosphorylation is impaired in cathepsin X-deficient prostate cancer cells.
22974233 2012 Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
22822386 2012 Novel Compound Heterozygous Mutations in the Cathepsin K Gene in Japanese Female Siblings with Pyknodysostosis.
22730330 2012 Cathepsin S cannibalism of cathepsin K as a mechanism to reduce type I collagen degradation.
22614014 2013 Macrophage cathepsin K promotes prostate tumor progression in bone.
22569910 2012 Cathepsin K preferentially solubilizes matured bone matrix.
22569264 2012 Clusterin is a specific stabilizer and liberator of extracellular cathepsin K.
22562303 2012 Tumor necrosis factor alpha stimulates cathepsin K and V activity via juxtacrine monocyte-endothelial cell signaling and JNK activation.
21983785 2011 Genome-wide association study identifies a new melanoma susceptibility locus at 1q21.3.
21880134 2011 Constitutive expression of cathepsin K in the human intervertebral disc: new insight into disc extracellular matrix remodeling via cathepsin K and receptor activator of nuclear factor-?B ligand.
21874011 2012 Cathepsin K expression in the spectrum of perivascular epithelioid cell (PEC) lesions of the kidney.
21756348 2011 Multiplex zymography captures stage-specific activity profiles of cathepsins K, L, and S in human breast, lung, and cervical cancer.
21715684 2011 Regulation of chemerin chemoattractant and antibacterial activity by human cysteine cathepsins.
21602817 2011 Differential expression of cathepsin K in neoplasms harboring TFE3 gene fusions.
21099701 2011 Familial pycnodysostosis: identification of a novel mutation in the CTSK gene (cathepsin K).
21086906 2010 Cathepsin-K is a sensitive immunohistochemical marker for detection of micro-granulomas in hypersensitivity pneumonitis.
20837372 2010 Serum cathepsin levels in coronary artery ectasia.
20727023 2010 Cathepsin K expression: a useful marker for the differential diagnosis of dermatofibroma and dermatofibrosarcoma protuberans.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20494937 2010 Cathepsin X is secreted by human osteoblasts, digests CXCL-12 and impairs adhesion of hematopoietic stem and progenitor cells to osteoblasts.
20450492 2010 Conformational flexibility and allosteric regulation of cathepsin K.
20430722 2009 Expression of syndecan-1 and cathepsins D and K in advanced esophageal squamous cell carcinoma.
20305575 2010 A novel missense mutation in cathepsin K (CTSK) gene in a consanguineous Pakistani family with pycnodysostosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19886543 2009 Cathepsin-k as a diagnostic marker in the identification of micro-granulomas in Crohn's disease.
19800993 2010 A cysteine-type carboxypeptidase, cathepsin X, generates peptide receptor agonists.
19750481 2009 Cathepsin X cleaves the beta2 cytoplasmic tail of LFA-1 inducing the intermediate affinity form of LFA-1 and alpha-actinin-1 binding.
19700761 2009 Bone marrow-derived cathepsin K cleaves SPARC in bone metastasis.
19674475 2009 A mutation in CTSK gene in an autosomal recessive pycnodysostosis family of Pakistani origin.
19469903 2009 Expression and regulation of cathepsin K in skin fibroblasts.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19446361 2009 Cathepsin X prevents an effective immune response against Helicobacter pylori infection.
19433310 Cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase and impairs survival and neuritogenesis of neuronal cells.
19428782 2009 Cathepsin K generates enkephalin from beta-endorphin: a new mechanism with possible relevance for schizophrenia.
19396149 2009 Cathepsin-K immunoreactivity distinguishes MiTF/TFE family renal translocation carcinomas from other renal carcinomas.
19371798 2009 The -9247 T/C polymorphism in the SOST upstream regulatory region that potentially affects C/EBPalpha and FOXA1 binding is associated with osteoporosis.
19338743 2009 Cathepsin K: a therapeutic target for bone diseases.
19194656 2009 Cathepsin X-mediated beta2 integrin activation results in nanotube outgrowth.
19060845 2009 Cathepsin-k expression in pulmonary lymphangioleiomyomatosis.
18979635 2008 Regulation of cathepsin K activity by hydrogen peroxide.
18949742 Cathepsin B, cathepsin H, cathepsin X and cystatin C in sera of patients with early-stage and inflammatory breast cancer.
18765527 2008 Epithelial and stromal cathepsin K and CXCL14 expression in breast tumor progression.
18692071 2008 The crystal and molecular structures of a cathepsin K:chondroitin sulfate complex.
18664521 2008 Species differences between human and rat in the substrate specificity of cathepsin K.
18664495 2008 The role of cathepsin X in the migration and invasiveness of T lymphocytes.
18511517 2008 Cleavage of type II collagen by cathepsin K in human osteoarthritic cartilage.
18368130 2008 Cathepsin K in melanoma invasion.
18163891 2008 Cathepsin V, but not cathepsins L, B and K, may release angiostatin-like fragments from plasminogen.
18053985 2008 Interactions of myeloma cells with osteoclasts promote tumour expansion and bone degradation through activation of a complex signalling network and upregulation of cathepsin K, matrix metalloproteinases (MMPs) and urokinase plasminogen activator (uPA).
17991740 2008 Cathepsins B, K, and L are regulated by a defined collagen type II peptide via activation of classical protein kinase C and p38 MAP kinase in articular chondrocytes.
17889653 2007 An intracellular serpin regulates necrosis by inhibiting the induction and sequelae of lysosomal injury.
17882010 Cathepsin K predicts femoral neck bone mineral density change in nonosteoporotic peri- and early postmenopausal women.
17728092 2008 Circulating cathepsin K and cystatin C in patients with cancer related bone disease: clinical and therapeutic implications.
17683065 2008 Cathepsins and osteosarcoma: Expression analysis identifies cathepsin K as an indicator of metastasis.
17397052 2007 Molecular analysis and characterization of nine novel CTSK mutations in twelve patients affected by pycnodysostosis. Mutation in brief #961. Online.
17230547 2007 Cathepsin K and schizophrenia.
17227755 2007 Interaction between human cathepsins K, L, and S and elastins: mechanism of elastinolysis and inhibition by macromolecular inhibitors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16946716 2007 Role of cathepsin K in the turnover of the dermal extracellular matrix during scar formation.
16912123 2006 Cathepsin K in adipocyte differentiation and its potential role in the pathogenesis of obesity.
16831915 2006 The regulation of cathepsin K gene expression.
16774752 2006 Carboxypeptidase cathepsin X mediates beta2-integrin-dependent adhesion of differentiated U-937 cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16354158 2006 Active cathepsins B, H, K, L and S in human inflammatory bronchoalveolar lavage fluids.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337236 2006 Human osteoblasts produce cathepsin K.
15929988 2005 Proteolytic excision of a repressive loop domain in tartrate-resistant acid phosphatase by cathepsin K in osteoclasts.
15878337 2005 Carboxypeptidases cathepsins X and B display distinct protein profile in human cells and tissues.
15837295 2005 A structural screening approach to ketoamide-based inhibitors of cathepsin K.
15826870 2005 Differential turnover of cortical and trabecular bone in transgenic mice overexpressing cathepsin K.
15797245 2005 Cathepsin X binds to cell surface heparan sulfate proteoglycans.
15737607 2005 Carboxy-monopeptidase substrate specificity of human cathepsin X.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304486 2004 Essential role of p38 mitogen-activated protein kinase in cathepsin K gene expression during osteoclastogenesis through association of NFATc1 and PU.1.
15161653 2004 Pivotal role of cathepsin K in lung fibrosis.
14753734 2004 Characterization of common genetic variants in cathepsin K and testing for association with bone mineral density in a large cohort of perimenopausal women from Scotland.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14645229 2004 Regulation of collagenase activities of human cathepsins by glycosaminoglycans.
12887056 2003 Cleavage site specificity of cathepsin K toward cartilage proteoglycans and protease complex formation.
12652657 2003 Identification of cathepsin K as a novel marker of adiposity in white adipose tissue.
12568399 2003 Cathepsin K mRNA and protein expression in prostate cancer progression.
12504904 2003 Inhibition of the cysteine proteinases cathepsins K and L by the serpin headpin (SERPINB13): a kinetic analysis.
12492488 2003 Kininogen-derived peptides for investigating the putative vasoactive properties of human cathepsins K and L.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12125807 2002 Pycnodysostosis: role and regulation of cathepsin K in osteoclast function and human disease.
12081494 2002 Selective inhibition of the collagenolytic activity of human cathepsin K by altering its S2 subsite specificity.
12039963 2002 Collagenase activity of cathepsin K depends on complex formation with chondroitin sulfate.
11733367 2001 Cathepsin k is a critical protease in synovial fibroblast-mediated collagen degradation.
10878663 2000 Cathepsin K gene mutations and 1q21 haplotypes in at patients with pycnodysostosis in an outbred population.
10849755 2000 Cathepsin K expression in human lung.
10719280 2000 Immunochemical characterization of assay for carboxyterminal telopeptide of human type I collagen: loss of antigenicity by treatment with cathepsin K.
10491211 1999 Mutations of CTSK result in pycnodysostosis via a reduction in cathepsin K protein.
10048321 1999 Crystal structure of wild-type human procathepsin K.
9893980 1999 The crystal structure of human procathepsin K.
9548757 1998 Cross-class inhibition of the cysteine proteinases cathepsins K, L, and S by the serpin squamous cell carcinoma antigen 1: a kinetic analysis.
9529353 1998 Paternal uniparental disomy for chromosome 1 revealed by molecular analysis of a patient with pycnodysostosis.
9405598 1997 Design of potent and selective human cathepsin K inhibitors that span the active site.
9276160 1997 Characterization of kininogenase activity of an acidic proteinase isolated from human kidney.
9143502 1997 Structure and chromosomal assignment of the human cathepsin K gene.
9143491 1997 Genomic organization and chromosome localization of the human cathepsin K gene (CTSK).
9033587 1997 Crystal structure of human cathepsin K complexed with a potent inhibitor.
9028530 1997 Localization of cathepsin K in human osteoclasts by in situ hybridization and immunohistochemistry.
8938428 1996 A nonsense mutation in the cathepsin K gene observed in a family with pycnodysostosis.
8703060 1996 Pycnodysostosis, a lysosomal disease caused by cathepsin K deficiency.
8647860 1996 Proteolytic activity of human osteoclast cathepsin K. Expression, purification, activation, and substrate identification.
8585423 1995 Cloning and complete coding sequence of a novel human cathepsin expressed in giant cells of osteoclastomas.
7929457 1994 Human cathepsin O. Molecular cloning from a breast carcinoma, production of the active enzyme in Escherichia coli, and expression analysis in human tissues.
7818555 1995 Molecular cloning of human cDNA for cathepsin K: novel cysteine proteinase predominantly expressed in bone.
7805878 1995 Molecular cloning of human cathepsin O, a novel endoproteinase and homologue of rabbit OC2.
7576232 1995 Human cathepsin O2, a novel cysteine protease highly expressed in osteoclastomas and ovary molecular cloning, sequencing and tissue distribution.
7492318 1995 Evaluation of the extent of the binding site in human tissue kallikrein by synthetic substrates with sequences of human kininogen fragments.