Property Summary

NCBI Gene PubMed Count 66
PubMed Score 221.97
PubTator Score 101.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.040 4.4e-03
adrenocortical carcinoma -1.133 1.1e-02
esophageal adenocarcinoma 1.200 2.4e-02
group 4 medulloblastoma -1.900 2.7e-06
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-02
invasive ductal carcinoma 1.091 1.6e-02
lung adenocarcinoma -1.200 5.5e-03
lung cancer -3.600 9.7e-06
lung carcinoma -3.900 2.0e-35
medulloblastoma, large-cell -1.900 7.3e-05
mucosa-associated lymphoid tissue lympho... 1.774 3.7e-02
nephrosclerosis -1.462 1.2e-02
non-small cell lung cancer -1.680 9.9e-16
ovarian cancer -1.800 2.9e-05
posterior fossa group A ependymoma 1.400 1.5e-05
subependymal giant cell astrocytoma 3.662 2.5e-03
tuberculosis 1.200 1.5e-07

Gene RIF (33)

AA Sequence

MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNN      1 - 70
GNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGS     71 - 140
CWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGK    141 - 210
DGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVN    211 - 280
HAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV                   281 - 335
//

Text Mined References (73)

PMID Year Title