Property Summary

Ligand Count 25
NCBI Gene PubMed Count 26
PubMed Score 49.37
PubTator Score 27.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.050 6.9e-04
Breast cancer -1.200 2.6e-04
glioblastoma -1.400 4.7e-04
intraductal papillary-mucinous neoplasm ... -1.400 3.7e-03
malignant mesothelioma -2.300 4.5e-08
medulloblastoma, large-cell -1.800 3.3e-04
Multiple myeloma 1.274 3.0e-03
ovarian cancer -2.000 2.2e-07
pediatric high grade glioma -1.200 2.6e-04
primitive neuroectodermal tumor -1.300 1.0e-03
psoriasis -1.100 2.1e-59

Gene RIF (9)

AA Sequence

MAPWLQLLSLLGLLPGAVAAPAQPRAASFQAWGPPSPELLAPTRFALEMFNRGRAAGTRAVLGLVRGRVR      1 - 70
RAGQGSLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFQVLDELGRHVLLRKDCGPVDTKVPGAGEPKSA     71 - 140
FTQGSAMISSLSQNHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEEARWRLSV    141 - 210
FVNNMVRAQKIQALDRGTAQYGVTKFSDLTEEEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPEWDWRSK    211 - 280
GAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGG    281 - 350
LETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPL    351 - 420
RPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD          421 - 484
//

Text Mined References (28)

PMID Year Title