Property Summary

NCBI Gene PubMed Count 267
PubMed Score 4405.48
PubTator Score 2020.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (23)

Disease log2 FC p
glioblastoma 2.500 7.0e-03
malignant mesothelioma -1.100 2.9e-06
cutaneous lupus erythematosus 1.800 2.7e-04
osteosarcoma 2.614 1.9e-04
medulloblastoma -1.700 2.9e-05
cystic fibrosis 1.984 4.3e-06
astrocytoma 2.200 1.1e-02
atypical teratoid / rhabdoid tumor -1.200 3.0e-03
medulloblastoma, large-cell -3.100 3.1e-05
Duchenne muscular dystrophy 1.102 3.2e-06
juvenile dermatomyositis 1.248 2.2e-09
acute quadriplegic myopathy 1.454 2.5e-06
primary pancreatic ductal adenocarcinoma 1.745 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
lung cancer -1.100 1.1e-03
pancreatic cancer 2.000 3.0e-03
breast carcinoma 2.400 2.3e-03
subependymal giant cell astrocytoma 2.032 1.7e-02
invasive ductal carcinoma 1.676 1.9e-05
inflammatory breast cancer 1.700 3.1e-06
lung carcinoma -1.100 2.9e-14
gastric carcinoma 2.000 2.7e-02
ovarian cancer 3.600 1.7e-06

Protein-protein Interaction (2)

Gene RIF (191)

PMID Text
27031837 Cathepsin B knockdown in oral cancer cells reduces cell migration.
26904684 High activity of cathepsin B and increased level of cystatin C are typical for women in late pregnancy. Those levels significantly decrease after delivery which can be associated with potential role of those markers in placental separation
26896959 CTSB might be involved in the development and progression of hepatocellular carcinoma.
26081835 shedding of surface proteins by extracellular cathepsins impacts intracellular signaling as demonstrated for regulation of Ras GTPase activity.
25991043 The serum level of cathepsin L decreased with age, while cathepsin B remained no significant difference between young and aged individuals
25959927 the authors applied the technique of nanoelectrode arrays to try to detect and compare cathepsin B activities in normal and breast cancer cells. It was found that protease activity correlated positively with the degree of malignancy cancer cells.
25883214 High cathepsin is associated with drug resistance in neuroblastoma.
25802234 SCD5 impairs SPARC and cathepsin B secretion in human melanoma cells and intracellular pH acidification.
25633482 Cathepsins B and L activity correlates with the efficiency of reovirus-mediated tumor cell killing.
25577554 enhanced activity and expression of cathepsin B contributes to an increased remodelling of extracellular matrix that favours leiomyoma growth
25572981 Integrin alphavbeta3 is required for cathepsin B-induced hepatocellular carcinoma progression
25502766 The expressions of cathepsin B strongly correlated with the Mini-Mental State Examination scores of the Alzheimer disease. patients
25452305 Inactivation of tristetraprolin in chronic hypoxia provokes the expression of cathepsin B
25260629 data suggest that CTSB is a pathophysiologically relevant protease that activates ENaC in cystic fibrosis airways
25209871 Cathepsin B activity is increased in blood and CSF from HIV-infected cocaine users.
25106406 A4383C and C76G SNP in Cathepsin B is respectively associated with the high risk and tumor size of hepatocarcinoma.
25095637 Cathepsin D and B activities in the serum of patients with urothelial bladder cancer are directly proportional to disease severity and significantly higher compared with control group.
24862331 HIV-1 gp120 upregulates the expression of cathepsin B (CTSB) in human B cells
24790080 report identifies PARP1 as a novel modulator of two UHRF1-regulated heterochromatin-associated events: the accumulation of H4K20me3 and the clearance of DNMT1
24749816 Cathepsin B (CB) substantially contributes to the invasive phenotype of FLS that leads to joint destruction in RA.
24699410 Overexpression of uPAR and cathepsin B increases expression of cytosolic p-JNK.
24618814 CB was highly upregulated in human ESCC and its precursor lesions. The elevated CB expression in ESCC allowed in vivo and in vitro detection of ESCC xenografts in nude mice.
24595198 Cathepsin B produces full-length amyloid-beta (Ab(1-40/42)) and pyroglutamate amyloid-beta (pyroGluAb(3-40/42) and is a key drug target for treating Alzheimer's disease by reducing these amyloid-beta species
24215712 Data indicate that wild type and mutant amyloid precursor proteins (APP) expression enhances the induction in cathepsin B after administration of proteasome inhibitor MG132.
24166050 archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo.
24162774 HIV-1 gp120 upregulates the expression of cathepsin B (CTSB) in human B cells
24139065 Correlation between higher CTSB expression and lower survival rate in human lung squamous cell carcinoma.
24138030 These observations point to a critical regulatory role for that endogenous CD activity in dopaminergic cells in alpha-synuclein homeostasis which cannot be compensated for by increased Cathepsin B.
24108784 Data suggest that CTSB (cathepsin B) and CTSL (cathepsin L) of the autophagic-lysosomal proteolytic system are involved as the main proteolytic system in skeletal muscle during cancer cachexia development in patients with esophageal cancer.
24083575 Cathepsin B is a key drug target for reducing the brain damage and improving neuromuscular dysfunction resulting from traumatic brain injury (TBI).
24077280 Study shows that CTSB overexpression in the cancer cells increases growth of invasive ductal carcinoma in the MMTV-PyMT mouse model of breast cancer.
23874603 HIV-1 gp120 upregulates the expression of cathepsin B (CTSB) in human B cells
23867824 Reduced cathepsin B expression, effected by RNA interference, mimicked pharmacological inhibition of the enzyme and confirmed the contribution of cathepsin B to apoptotic events induced by DENV in HepG2 cells.
23867815 HIV-1 gp120 upregulates the expression of cathepsin B (CTSB) in human B cells
23708264 Depletion of Cathepsin B in vitro inhibited cell proliferation.
23677785 Thus, cathepsin L and cathepsin B are not required for human papillomavirus type 16 infection but instead appear to restrict infection.
23667900 Cathepsin B promotes proliferation and premalignant progression of breast epithelial cells.
23633927 Modulation of in vitro and in vivo glioblastoma cells growth characteristics by IGFBP-4 fragment CIBP-4 is associated with anti-cathepsin B activity.
23603447 our data demonstrate that chronic UVA inhibits both cathepsin B and L enzymatic activity and that dual inactivation of both enzymes is a causative factor underlying UVA-induced impairment of lysosomal function in dermal fibroblasts.
23591598 High cathepsin expression is associated with dysplasia and colitis-associated cancer.
23466190 Increased concentrations of cathepsins B, D and G in the proliferative eutopic endometrium may play a role in the implantation of endometrial tissue outside the uterine cavity.
23362198 The co-localization of stefin B wild type and EPM1 mutants with cathepsins showed that cathepsins accumulate around the aggregates formed by the EPM1 mutants.
23292187 Data indicate protein secretion pathways activated by monosodium urate (MSU) in macrophages, and reveal a novel role for cathepsin B and Src, Pyk2, PI3 kinases in the activation of unconventional protein secretion.
23222817 Highlighted the importance of uPAR and cathepsin B in the regulation of malignant stem cell self-renewal through hedgehog components, Bmi1 and Sox2.
23222509 Downregulation of uPAR and cathepsin B quenched TGF-beta1-driven invasion and survival of meningioma cells in a XIAP-dependent manner.
23219593 4-tert-octylphenol can adversely affect human health by promoting cancer proliferation and metastasis through the amplification of cathepsins B and D via the estrogen receptor-mediated signaling pathway
23195957 Netrin-1 promotes glioblastoma cell invasiveness and angiogenesis by multiple pathways including activation of RhoA, cathepsin B, and cAMP-response element-binding protein
23189279 The total cathepsin B activity and content calculated per gram of DNA were higher in Wharton's jelly than in the umbilical cord vessels, and the latter parameter was the lowest in the umbilical cord arteries.
23063511 Up-regulation of cysteine cathepsins B and L and TGF-beta production/signaling were required for the activation of fibroblasts and their promotion of the invasive growth of melanoma cells.
23024364 enhancing CatB activity could lower Abeta, especially Abeta42, in AD patients with or without familial mutations.
22949512 Reduced cathepsins B and D cause impaired autophagic degradation that can be almost completely restored by overexpression of these two proteases in Sap C-deficient fibroblasts.
22851129 the genetic polymorphism of CTSB A8422G (rs8898) was associated with a high risk for the clinicopathological development of oral cancer
22782900 Cathepsin B may cleave ENaC extracellularly after being secreted or intracellularly, while ENaC is present in the Golgi or in recycling endosomes.
22745374 Memory cells are protected from lysosomal breakdown by inhibition of CTSB; CTSB is a physiological target of (Spi)2A in memory CD8-positive T cell survival.
22732093 Gene expression profiles of ASC or CatB deficient human DCs show marked overlap with downregulation of genes implicated in DC function.
22695494 The activity of cathepsin B and L in blood significantly increased with age.
22693552 the role of cathepsin B in neuronal cell death induced by HIV-infected macrophages
22571763 Seminal plasma cathepsin B was approximately 70 times higher, while the cathepsin L values were approximately 500 times higher and the cathepsin S values approximately 40 times higher in seminal plasma than in a group of serum samples.
22467319 Cathepsin B concentrations correlate well with grading and invasivity of tumors.
22464443 signaling network activates the transcription of cathepsin B gene via myeloid zinc finger-1 transcription factor that binds to an ErbB2-responsive enhancer element in the first intron of cathepsin B
22384200 up-regulation of endothelial CTSB due to Fli1 deficiency may contribute to the development of SSc vasculopathy
22322590 Acid ceramidase, through sphingosine 1-phosphate, promotes an invasive phenotype in prostate cancer by causing overexpression and secretion of cathepsin B through activation and nuclear expression of Ets1.
22287159 Elevated cathepsin B level is associated with invasive glioblastoma.
22278224 Activation of the Nipah virus fusion protein is mediated by cathepsin B within the endosome.
22266111 our findings established a prometastatic role for cathepsin B in distant metastasis
22262857 an acute siRNA-mediated loss of TRPML1 specifically causes a leak of lysosomal protease cathepsin B (CatB) into the cytoplasm. CatB leak is associated with apoptosis, which can be prevented by CatB inhibition.
22222211 Cathepsins B and L activate Ebola but not Marburg virus glycoproteins for efficient entry into cell lines and macrophages independent of TMPRSS2 expression.
22209964 Cathepsin B and cystatin C may play a role in the diagnosis and clinical assessment of the severity of community-acquired pneumonia, which could potentially guide the development of treatment strategies
22138708 HIV-1 gp120 upregulates the expression of cathepsin B (CTSB) in human B cells
22127599 Cathepsin B may contribute to both cervical cancer cell proliferation and invasion.
22066471 Cysteine cathepsins B, K, and L constitutively secreted by osteoblasts are part of the fine-tuned regulation of CXCL12 in the bone marrow.
21967108 Cathepsin B endopeptidase specificity is primarily guided by a strong selectivity for glycine.
21948970 AGR2 is a novel surface antigen that promotes the dissemination of pancreatic cancer cells through regulation of cathepsins B and D.
21945151 CTSB and FDFT1 are excluded as candidates for keratolytic winter erythema
21925292 Recently discovered biological roles of cathepsins L and B indicate their significance in human health and disease.
21880013 Data show that mRNA levels of the two main lysosomal enzymes (cathepsin B and L) were not changed but, conversely, genes related to calpain and caspase had a higher expression in the muscles of the patients.
21850018 Analysis of the data led to the elucidation of a new molecular mechanism by which SPARC promotes cathepsin B-mediated melanoma invasiveness using collagen I and alpha2beta1 integrins as mediators.
21840777 Cathepsin B and uPAR downregulation reduced tumor growth and increased p27 nuclear expression in vivo.
21835790 These data suggest that adenovirus 5 infection induces endosomal membrane rupture and release lysosomal cathepsin B that leads to mitochondrial membrane disruption and release of reactive oxygen species from the mitochondria.
21742978 Processing of human protryptase in mast cells involves cathepsins L, B, and C.
21600167 Over-expression of cathepsin B promotes TNF--induced vascular smooth muscle cells apoptosis; gene silencing of cathepsin B inhibited this effect.
21585286 The cathepsin B deserves further evaluation as therapeutic targets to develop disease modifying drugs to treat Alzheimer's disease.
21562164 CTSL and CTSB are capable of directly processing both alpha- and beta-protryptases from human mast cells to their mature enzymatically active products.
21541353 These results suggest that endocytosis, endosomal acidification, and cathepsin B activity are involved in the CD4-independent entry of HIV-1.
21508263 Data show that SAA can induce the expression of pro-IL-1beta and activation of the NLRP3 inflammasome via P2X(7) receptor and a cathepsin B-sensitive pathway.
21323990 review of its association with chronic pancreatitis in the Asia Pacific region
21250859 Serum cathepsin B showed significantly higher values 4 days after surgery in comparison with samples collected prior to surgery
21199580 CTSB may initiate proteolytic pathways crucial for inflammatory breast cancer invasion and a potential prognostic marker for lymphatic metastasis.
21112096 We investigated the modulation of Cathepsin S, Cathepsin B and Cystatin C expression in immune cells by interferon (IFN)-beta, and their role in cell migration
21092200 This report describes a novel aspect of the pathogenesis of Legionnaires' disease and provides a possible therapeutic target for the regulation of inflammation.
21060833 RNAi-mediated downregulation of uPAR and cathepsin B initiates caspase-dependent mitochondrial apoptosis in U251 cells and caspase-independent mitochondrial apoptosis in 5310 cells
20930303 Plasma cathepsin B levels were higher in persons with Alzheimer disease compared to healthy controls whereas there was no difference between diagnostic groups in cathepsin B levels in CSF.
20880494 Data show that plasma levels of cathepsin S mRNA, but not cathepsin B mRNA, are increased in patients with coronary atherosclerosis.
20833970 cathepsin B is expressed in the vast majority of colon cancers, independent of stage, and is significantly associated with higher risk of colon cancer-specific and overall mortality
20699092 high correlation between the cathepsin B/cystatin C system and markers of joint inflammation in acute gout of the knee, demonstrating the pathologic role of cathepsin B and cystatin C in inflammation
20661471 Findings provide molecular mechanism for the G0/G1 arrest induced by the downregulation of cathepsin B and uPAR in SNB19 and U251 glioma cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627011 Cathepsin B may be involved in the formation and the progression of intracranial aneurysm.
20584670 High expression of cathepsin B is closely associated with tumor infiltration and lymphatic metastasis of cervical cancer.
20567828 Results suggest a potential utility of CTSL and CTSB as prognostic markers for this malignancy.
20563251 High Cathepsin B is associated with esophageal cancer.
20536394 Cathepsin B is localized to endo-lysosomes in thyroid carcinoma cells. Additionally, a proteolytically active variant of cathepsin B (slightly smaller than the cathepsin B proform) is localized to cell nucleus in some thyroid carcinoma cell lines.
20424577 Cathepsin B activities are increased in acromegaly.
20302512 arsenite toxicity involves a complex interplay between autophagy and apoptosis in human glioblastoma cells and is associated with inhibition of Cathepsin B, and that this toxicity is highly exacerbated by simultaneous Cathepsin L inhibition.
20180636 cathepsin B was found to be significantly elevated in rheumatoid arthritis and osteoarthritis synovial fluid.
20042316 Expression of Cathepsin B increases along with the cancerisation in OSCC both in vitro and in vivo, and it may serve as a candidate biomarker of OSCC.
20008285 L. monocytogenes-infected human PBMCs produced IL-1beta, largely depending on an LLO-mediated phagosomal rupture and cathepsin B release, which is sensed by Nlrp3
19930869 Polymorphism L26V in the cathepsin B gene may be associated with prostate cancer and differentiation.
19930869 Observational study of gene-disease association. (HuGE Navigator)
19915865 Levels of CatB and CysC were higher in CF of malignant serous tumors compared to those found in benign serous tumors whereas levels of CatL were significantly higher in CF of malignant mucinous tumors compared to those found in benign mucinous tumors
19913121 Observational study of gene-disease association. (HuGE Navigator)
19811804 High-risk HPV types may be associated with oral carcinoma, by cell-cycle control dysregulation, contributing to oral carcinogenesis and the overexpression of mdm2, p27 and cathepsin B.
19774387 These results suggest that cathepsin B and PAI-1 are important biomarkers for the stratification of glioblastoma patients with respect to survival.
19700239 glioblastoma cells may be attracted by endothelial cells, enhancing their proliferation and underlines the importance of SDF-1, cathepsin B and MMP-9 in the cross-talk between these cells in normoxic conditions
19692168 Observational study of gene-disease association. (HuGE Navigator)
19661440 LPS can activate a Cat-B-dependent programmed death response in human endothelial cells
19454696 Granulysin can target lysosomes to induce partial release of lysosomal contents into the cytosol; relocalized lysosomal cathepsin B can process Bid to active tBid to cause cytochrome c and apoptosis-activating factor release from mitochondria.
19434518 Cathepsin B activity was involved in the invasion of glioblastoma cells, confirming previous notion of cathepsin B as tumour invasiveness biomarker.
19414800 N. gonorrhoeae activates the cysteine protease cathepsin B
19331819 Results demonstrate through live-cell imaging extracellular matrix degradation in association with active cathepsin B in caveolae of endothelial cells during tube formation.
19040356 the properties of murine and human cathepsin B exhibited similar biochemical properties
19004543 Hh targets CATB, and Hh signaling through CATB might influence pancreatic cancer cell invasiveness
18949742 cathepsin B, cathepsin H, cathepsin X and cystatin C may have roles in inflammatory breast cancer
18760860 Simultaneous high expression of Cathepsins B and K is associated with recurrence in pulmonary adenocarcinomas and squamous cell carcinomas.
18714186 Determination of serum CATB and plasma UPA levels may be useful to identify patients at a higher risk for progression to cancer.
18706099 co-existence of TCF7L2 variants and the SPINK1 and CTSB mutations, that predict susceptibility to exocrine damage, may interact to determine the onset of diabetes in TCP patients
18706099 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18616803 blood levels are significantly elevated in patients with colorectal adenoma and colorectal carcinoma
18598236 The up-regulation of cathepsin B by NF-kappaB, followed by its secretion into the extracellular environment, might be partly responsible for the previously reported invasiveness of the mtDNA-depleted 143B osteosarcoma cells.
18566436 intracellular cathepsin B activity is involved in the TNF-alpha-containing vesicle trafficking to the plasma membrane
18566385 Activities of cathepsins B and D in the lysate of necrotic rho0 cells were inhibited by the addition of apoptotic parental Jurkat cell lysate
18543249 Concluded that IL-6/sIL-6R enhances cathepsin B and L production via IL-6/sIL-6R-mediated Cav-1-JNK-AP-1 pathway in human gingival fibroblasts.
18515357 Thechagasin-cathepsin B complex provides a structural framework for modeling and design of inhibitors for cruzipain, the parasite cysteine protease and a virulence factor in Chagas disease.
18472965 Cathepsin B mediates the pH-dependent proinvasive activity of tumor-shed microvesicles in ovarian cancer
18314113 Imbalanced serum concentration between cathepsin B and cystatin C in patients with pelvic inflammatory disease.
18296264 These results may suggest that the expression of matrix metalloproteinase-9 (MMP-9) and cathepsin B is correlated with lymph node metastasis in advanced gastric carcinoma, but not with patients' postoperative survival.
18163891 did not detect any plasminogen degradation by cathepsins B, K and L.
17991740 Induction of cathepsin B is associated with the activation of protein p38 MAP kinase.
17990360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17990360 Polymorphisms in reg1alpha gene, including the regulatory variants singly or in combination with the known mutations in SPINK1 and/or CTSB genes, are not associated with tropical calcific pancreatitis.
17982689 Data show that cathepsin B is involved in Bacillus Calmette-Guerin-induced apoptosis of transitional cancer cell lines, using at least in part the mitochondrial pathway.
17726009 glycosaminoglycans may play a physiological role in the activation of procathepsin B
17724614 Cyclosporine down regulated Cathepsin B.
17519890 level of active cathepsin B and L is increased in tumors
17507477 Data show that insulin-like growth factor II receptor-mediated intracellular retention of cathepsin B is essential for transformation of endothelial cells by Kaposi's sarcoma-associated herpesvirus.
17504810 Differentially regulated beta-catenin pools associate with the E-cadherin-gamma-secretase adherens junction complex; one pool regulated by gamma-secretase is important to intestinal epithelial cell homeostasis.
17064696 SK1 is cleaved by cathepsin B in a sequential manner after basic amino acids, and the initial cleavages at the two identified sites, histidine 122 and arginine 199, occur independently of each other.
16914553 cathepsin B is not essential for protection of cytotoxic lymphocytes from the toxic effects of their secreted perforin
16913838 expression of human cathepsin L (CSTL) through a genomic transgene results in widespread expression of human CTSL in the mouse that is capable of rescuing the lethality found in CTSB/CTSL double-deficient animals
16894574 These data imply that confluent cells undergo spontaneous cell death mediated by cathepsin B; Lipopolysaccharides may accelerate this caspase-independent cell death through release of mitochondrial contents and reactive oxygen species.
16733801 hSB1 may function as a regulator of cathepsin B-mediated apoptosis.
16709808 Cathepsin B specifically cleaves off four C-terminally located amino acids of human CCL20 and generates a CCL20(1-66) isoform with full functional activity.
16534247 Cathepsin B caused activation of trypsinogen-1 with a trypsin yield of about 30% of that produced by enterokinase. Proelastase and procarboxypeptidase B was not activated by cathepsin B.
16492714 Observational study of gene-disease association. (HuGE Navigator)
16381007 results strongly implicate a pivotal role of cell-matrix interactions for the regulation of cathepsin B localization and activity in melanoma cells
16315320 These results show that, besides multiple regulatory molecules, intracellular cathepsin B also contributes to the neovascularization process and should be considered as a potential therapeutic target.
16077201 Cathepsin B substrate, BID, serves as molecular switch between apotosis and autophagy in camptothecin treated breast cancer cells.
16051222 Cathepsin B is responsble for the degradation of insulin-like growth factor-I in endosomes.
16034129 The cathepsin B death pathway is cell type-specific and may contribute to inflammatory cytokine-mediated human tissue injury
15832773 protein levels of cathepsins B (p=0.050) and L (p=0.019) were found to be significantly higher in atypical than in benign meningiomas
15831716 Plays a role in Ebola virus entry into cells
15816632 cathepsins B and L have roles in atypical pituitary adenoma
15807897 results suggest that besides the N-terminal signal peptide also other CB domains contain patterns which are responsible for a differentiated targeting of the molecule, e.g. to the mitochondria, to the nucleus, or to vesicles.
15799821 tumor-stromal interactions in the context of the bone microenvironment can modulate the expression of the cysteine protease cathepsin B
15710602 SK1 down-regulation by TNF is dependent on the lysosomal pathway of apoptosis and specifically on cathepsin B, which functions as an SK1 protease in cells
15679122 Cathepsin B is a protease that contributes to the remodelling of the extracellular matrix and thereby promotes keratinocyte migration during wound healing.
15512772 Mechanical stress (compression and tension forces) causes an increase in secretion of cathepsins B and L in periodontal ligament cells in vitro.
15274632 Extensive mass spectrometry of purified proteins separated under denaturing conditions strongly suggests that presenilin N- and C-terminal fragments, nicastrin, Aph-1, and presenilin enhancer-2 are components of the active gamma-secretase complex.
15262981 excessive transcription of the cathepsin B message lacking exons 2 and 3 has significant consequences on cell life
15255544 endothelial cell-associated cathepsins B and L are not involved in the invasive growth of capillaries from existing blood vessels and the presence of collagen is necessary for MMP2 expression in endothelial cells
15122332 RNAi inhibits CPSB gene expression in a glioblastoma cell line.
15100281 Cathepsin B is released and catalytically active in T lymphocyte cytosol during supraoptimal activation-induced apoptosis of T cells in vitro and may participate in high dose tolerance in vivo.
15016552 role for cathepsin B is reported in human papillomavirus-induced apoptotic signalling
14984956 No significant difference in serum cathepsin B levels was observed between patients with benign and malignant ovarian disease.
14730346 Blockade of CTSB expression in glioblastoma cells is associated with suppression of angiogenesis.
14729603 Central role for the lysosomal protease cathepsin B in mediating cell death in lung cancer cells.
12926111 The expression of cathepsin B in non-small cell lung cancer should be considered as a significant prognostic parameter.
12893746 T-cell apoptosis induced by antithymocyte globulins was associated with the release of active cathepsin B into the cytosol
12887051 REVIEW: focus on the molecular regulation of cathepsin B and attendant implications for tumor progression and arthritis; the potential of cathepsin B as a therapeutic target
12726991 In normal conditions and in the presence of IL-1beta, cathepsin B is involved in the activation of plasminogen activator in osteoblasts.
12677446 cathepsin B is involved in the motor neuron degeneration in ALS.
12589965 production of cathepsins B and H by tumor cells along with concomitant decrease of their inhibitor, cystatin C, in the CSF might contribute in the process of metastasis and spread of the cancer cells in the leptomeningeal tissues
12581740 Intracellular and extracellular cathepsin B facilitate invasion of MCF-10A neoT cells through reconstituted extracellular matrix in vitro.
12437120 Cathepsin B expression is significantly associated with the stage of ovarian cancer, debulking success and with progesterone receptors, and may have a role in ovarian cancer pathogenesis.
12201820 Cathepsin B carboxydipeptidase specificity analysis using internally quenched fluorescent peptides.
12185082 cathepsin B plays a role in controlling cell death and in limiting damage-associated inflammation
12086583 examination of expression of cathepsin B in articular chondrocytes and two lines of immortalized human chondrocytes
12072442 Interaction of human breast fibroblasts with collagen I increases total cathepsin B protein levels
11932257 Presence of cathepsin B in the human pancreatic secretory pathway and its role in trypsinogen activation during hereditary pancreatitis
11815600 role of exocytosis in phorbol ester activation of a proteolytic cascade capable of activating latent transforming growth factor beta
11513559 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQ      1 - 70
RVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLT     71 - 140
CCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKI    141 - 210
CEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAI    211 - 280
RILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI               281 - 339
//

Text Mined References (270)

PMID Year Title
27031837 2016 Cathepsin B Expression and the Correlation with Clinical Aspects of Oral Squamous Cell Carcinoma.
26904684 2016 Activity of Proteolytic Enzymes and Level of Cystatin C in the Peripartum Period.
26896959 2016 Over-expression of cathepsin B in hepatocellular carcinomas predicts poor prognosis of HCC patients.
26081835 2015 Proteomic Identification of Cysteine Cathepsin Substrates Shed from the Surface of Cancer Cells.
25991043 Differential levels of cathepsin B and L in serum between young and aged healthy people and their association with matrix metalloproteinase 2.
25959927 2015 Quantitative electrochemical detection of cathepsin B activity in breast cancer cell lysates using carbon nanofiber nanoelectrode arrays toward identification of cancer formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25883214 2015 Inhibition of cathepsin proteases attenuates migration and sensitizes aggressive N-Myc amplified human neuroblastoma cells to doxorubicin.
25802234 2015 SCD5-induced oleic acid production reduces melanoma malignancy by intracellular retention of SPARC and cathepsin B.
25633482 2015 Activity levels of cathepsins B and L in tumor cells are a biomarker for efficacy of reovirus-mediated tumor cell killing.
25577554 2015 Cathepsin B in human myometrium and in uterine leiomyomas at various stages of tumour growth.
25572981 2015 Integrin ?v?3 is required for cathepsin B-induced hepatocellular carcinoma progression.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
25452305 2015 Inactivation of tristetraprolin in chronic hypoxia provokes the expression of cathepsin B.
25260629 2014 Cathepsin B contributes to Na+ hyperabsorption in cystic fibrosis airway epithelial cultures.
25209871 2014 Cocaine potentiates cathepsin B secretion and neuronal apoptosis from HIV-infected macrophages.
25106406 2014 A4383C and C76G SNP in Cathepsin B is respectively associated with the high risk and tumor size of hepatocarcinoma.
25095637 2014 [Cathepsin D and B activity in the serum of patients with urothelial bladder cancer].
24790080 2014 Regulation of TGF-?1-driven differentiation of human lung fibroblasts: emerging roles of cathepsin B and cystatin C.
24749816 2014 Role of cathepsin B in regulating migration and invasion of fibroblast-like synoviocytes into inflamed tissue from patients with rheumatoid arthritis.
24699410 2014 uPAR and cathepsin B-mediated compartmentalization of JNK regulates the migration of glioma-initiating cells.
24677670 2014 Cathepsin B: multiple roles in cancer.
24618814 2014 Detection of esophageal squamous cell carcinoma by cathepsin B activity in nude mice.
24595198 2014 Brain pyroglutamate amyloid-? is produced by cathepsin B and is reduced by the cysteine protease inhibitor E64d, representing a potential Alzheimer's disease therapeutic.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24215712 2014 Wild type and mutant amyloid precursor proteins influence downstream effects of proteasome and autophagy inhibition.
24166050 2014 V-ATPase inhibition by archazolid leads to lysosomal dysfunction resulting in impaired cathepsin B activation in vivo.
24139065 2013 Cathepsin B as a potential prognostic and therapeutic marker for human lung squamous cell carcinoma.
24138030 2014 Over-expression of an inactive mutant cathepsin D increases endogenous alpha-synuclein and cathepsin B activity in SH-SY5Y cells.
24108784 2013 Autophagic-lysosomal pathway is the main proteolytic system modified in the skeletal muscle of esophageal cancer patients.
24083575 2014 The cysteine protease cathepsin B is a key drug target and cysteine protease inhibitors are potential therapeutics for traumatic brain injury.
24077280 2014 Cell type-dependent pathogenic functions of overexpressed human cathepsin B in murine breast cancer progression.
23867824 2013 Role of cathepsin B in dengue virus-mediated apoptosis.
23708264 2013 Silencing of Cathepsin B suppresses the proliferation and invasion of endometrial cancer.
23677785 2013 Human papillomavirus type 16 does not require cathepsin L or B for infection.
23667900 2012 Three-dimensional cultures modeling premalignant progression of human breast epithelial cells: role of cysteine cathepsins.
23633927 2013 IGFBP-4 anti-angiogenic and anti-tumorigenic effects are associated with anti-cathepsin B activity.
23603447 2013 UVA causes dual inactivation of cathepsin B and L underlying lysosomal dysfunction in human dermal fibroblasts.
23591598 2013 Fluorescence endoscopy of cathepsin activity discriminates dysplasia from colitis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23466190 2013 Determination of cathepsins B, D and G concentration in eutopic proliferative endometrium of women with endometriosis by the surface plasmon resonance imaging (SPRI) technique.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362198 2013 Influence of partial unfolding and aggregation of human stefin B (cystatin B) EPM1 mutants G50E and Q71P on selective cleavages by cathepsins B and S.
23292187 2013 Monosodium urate activates Src/Pyk2/PI3 kinase and cathepsin dependent unconventional protein secretion from human primary macrophages.
23222817 2013 Cathepsin B and uPAR regulate self-renewal of glioma-initiating cells through GLI-regulated Sox2 and Bmi1 expression.
23222509 2012 uPAR and cathepsin B shRNA impedes TGF-?1-driven proliferation and invasion of meningioma cells in a XIAP-dependent pathway.
23219593 2013 4-tert-Octylphenol stimulates the expression of cathepsins in human breast cancer cells and xenografted breast tumors of a mouse model via an estrogen receptor-mediated signaling pathway.
23195957 2013 Netrin-1 promotes glioblastoma cell invasiveness and angiogenesis by multiple pathways including activation of RhoA, cathepsin B, and cAMP-response element-binding protein.
23189279 2012 Differential distribution of cathepsin B in human umbilical cord tissues.
23063511 2012 TGF-? signaling, activated stromal fibroblasts, and cysteine cathepsins B and L drive the invasive growth of human melanoma cells.
23024364 2012 Cathepsin B degrades amyloid-? in mice expressing wild-type human amyloid precursor protein.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
22949512 2012 Reduced cathepsins B and D cause impaired autophagic degradation that can be almost completely restored by overexpression of these two proteases in Sap C-deficient fibroblasts.
22851129 2012 Cathepsin B SNPs elevate the pathological development of oral cancer and raise the susceptibility to carcinogen-mediated oral cancer.
22782900 2012 Cathepsin B is secreted apically from Xenopus 2F3 cells and cleaves the epithelial sodium channel (ENaC) to increase its activity.
22745374 2012 Cathepsin B controls the persistence of memory CD8+ T lymphocytes.
22732093 2012 Central and overlapping role of Cathepsin B and inflammasome adaptor ASC in antigen presenting function of human dendritic cells.
22695494 Cathepsin B and L activity in the serum during the human aging process: cathepsin B and L in aging.
22693552 2012 Dysregulation of macrophage-secreted cathepsin B contributes to HIV-1-linked neuronal apoptosis.
22571763 2012 High levels of cathepsins B, L and S in human seminal plasma and their association with prostasomes.
22467319 2012 Urine and serum cathepsin B concentrations in the transitional cell carcinoma of the bladder.
22464443 2012 ErbB2-driven breast cancer cell invasion depends on a complex signaling network activating myeloid zinc finger-1-dependent cathepsin B expression.
22384200 2012 A possible contribution of altered cathepsin B expression to the development of skin sclerosis and vasculopathy in systemic sclerosis.
22322590 2012 Acid ceramidase-mediated production of sphingosine 1-phosphate promotes prostate cancer invasion through upregulation of cathepsin B.
22287159 2012 The regulation of cysteine cathepsins and cystatins in human gliomas.
22278224 2012 Activation of the Nipah virus fusion protein in MDCK cells is mediated by cathepsin B within the endosome-recycling compartment.
22266111 2012 Cathepsin B inhibition limits bone metastasis in breast cancer.
22262857 2012 Loss of lysosomal ion channel transient receptor potential channel mucolipin-1 (TRPML1) leads to cathepsin B-dependent apoptosis.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22222211 2012 Cathepsins B and L activate Ebola but not Marburg virus glycoproteins for efficient entry into cell lines and macrophages independent of TMPRSS2 expression.
22209964 2012 Significant elevation of plasma cathepsin B and cystatin C in patients with community-acquired pneumonia.
22127599 2012 Cathepsin B may be a potential biomarker in cervical cancer.
22066471 2012 Processing of CXCL12 by different osteoblast-secreted cathepsins.
21967108 2011 Proteomic identification of protease cleavage sites characterizes prime and non-prime specificity of cysteine cathepsins B, L, and S.
21948970 2011 AGR2 is a novel surface antigen that promotes the dissemination of pancreatic cancer cells through regulation of cathepsins B and D.
21945151 2012 Exclusion of CTSB and FDFT1 as positional and functional candidate genes for keratolytic winter erythema (KWE).
21925292 2012 Cysteine Cathepsins in the secretory vesicle produce active peptides: Cathepsin L generates peptide neurotransmitters and cathepsin B produces beta-amyloid of Alzheimer's disease.
21880013 2012 Protein metabolism and gene expression in skeletal muscle of critically ill patients with sepsis.
21850018 2011 SPARC promotes cathepsin B-mediated melanoma invasiveness through a collagen I/?2?1 integrin axis.
21840777 2011 Mechanism of p27 upregulation induced by downregulation of cathepsin B and uPAR in glioma.
21835790 2011 Adenovirus type 5 rupture of lysosomes leads to cathepsin B-dependent mitochondrial stress and production of reactive oxygen species.
21742978 2011 Processing of human protryptase in mast cells involves cathepsins L, B, and C.
21600167 2011 [Cathepsin B promoted the apoptosis of vascular smooth muscle cells as induced by tumor necrosis factor-?].
21585286 2011 Cathepsins S, B and L with aminopeptidases display ?-secretase activity associated with the pathogenesis of Alzheimer's disease.
21562164 2011 Promiscuous processing of human alphabeta-protryptases by cathepsins L, B, and C.
21541353 2011 CD4-independent human immunodeficiency virus infection involves participation of endocytosis and cathepsin B.
21508263 2011 Serum amyloid A activates the NLRP3 inflammasome via P2X7 receptor and a cathepsin B-sensitive pathway.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21323990 2011 Genetic basis of chronic pancreatitis in Asia Pacific region.
21269460 2011 Initial characterization of the human central proteome.
21250859 2011 Inflammatory response is associated with increased cathepsin B and decreased cathepsin S concentrations in the circulation.
21217776 2011 Cathepsin H regulated by the thyroid hormone receptors associate with tumor invasion in human hepatoma cells.
21199580 2011 Cathepsin B: a potential prognostic marker for inflammatory breast cancer.
21112096 2011 Cathepsins (S and B) and their inhibitor Cystatin C in immune cells: modulation by interferon-? and role played in cell migration.
21092200 2010 Legionella pneumophila induces cathepsin B-dependent necrotic cell death with releasing high mobility group box1 in macrophages.
21060833 2010 Downregulation of uPAR and cathepsin B induces apoptosis via regulation of Bcl-2 and Bax and inhibition of the PI3K/Akt pathway in gliomas.
20930303 2010 Higher cathepsin B levels in plasma in Alzheimer's disease compared to healthy controls.
20880494 2010 Increased plasma levels of CATS mRNA but not CATB mRNA in patients with coronary atherosclerosis.
20833970 2010 Cathepsin B expression and survival in colon cancer: implications for molecular detection of neoplasia.
20706999 2010 Cytoskeletal scaffolding proteins interact with Lynch-Syndrome associated mismatch repair protein MLH1.
20699092 2010 Cathepsin B and cystatin C play an inflammatory role in gouty arthritis of the knee.
20661471 2010 Co-depletion of cathepsin B and uPAR induces G0/G1 arrest in glioma via FOXO3a mediated p27 upregulation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627011 2010 [The expression and role of Cathepsin B in intracranial aneurysm wall].
20584670 2010 [Clinical significance of cathepsin B expressions in cervical cancer in tissues].
20567828 2010 Cathepsins B and L in peripheral blood mononuclear cells of pediatric acute myeloid leukemia: potential poor prognostic markers.
20563251 2010 Cathepsin B is the driving force of esophageal cell invasion in a fibroblast-dependent manner.
20536394 2010 Nuclear cysteine cathepsin variants in thyroid carcinoma cells.
20424577 2010 The imbalance of cathepsin B-like activity in acromegalic patients--preliminary report.
20302512 2010 Differential role of cathepsins B and L in autophagy-associated cell death induced by arsenic trioxide in U87 human glioblastoma cells.
20180636 2010 Expression and activity profiling of selected cysteine cathepsins and matrix metalloproteinases in synovial fluids from patients with rheumatoid arthritis and osteoarthritis.
20042316 2010 Increased expression of Cathepsin B in oral squamous cell carcinoma.
20008285 2010 Listeria monocytogenes-infected human peripheral blood mononuclear cells produce IL-1beta, depending on listeriolysin O and NLRP3.
19930869 Polymorphism L26V in the cathepsin B gene may be associated with a risk of prostate cancer and differentiation.
19915865 2010 Cathepsins B, L and cystatin C in cyst fluid of ovarian tumors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19811804 2011 Abnormal cell-cycle expression of the proteins p27, mdm2 and cathepsin B in oral squamous-cell carcinoma infected with human papillomavirus.
19774387 2009 High expression of cathepsin B and plasminogen activator inhibitor type-1 are strong predictors of survival in glioblastomas.
19700239 2010 Glioblastoma and endothelial cells cross-talk, mediated by SDF-1, enhances tumour invasion and endothelial proliferation by increasing expression of cathepsins B, S, and MMP-9.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19661440 2009 Lipopolysaccharide can trigger a cathepsin B-dependent programmed death response in human endothelial cells.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19454696 2009 Granulysin induces cathepsin B release from lysosomes of target tumor cells to attack mitochondria through processing of bid leading to Necroptosis.
19434518 2009 Post-translational regulation of cathepsin B, but not of other cysteine cathepsins, contributes to increased glioblastoma cell invasiveness in vitro.
19414800 2009 Neisseria gonorrhoeae activates the proteinase cathepsin B to mediate the signaling activities of the NLRP3 and ASC-containing inflammasome.
19331819 2009 Live-cell imaging demonstrates extracellular matrix degradation in association with active cathepsin B in caveolae of endothelial cells during tube formation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19040356 2009 Murine and human cathepsin B exhibit similar properties: possible implications for drug discovery.
19004543 2009 Cathepsin B is a target of Hedgehog signaling in pancreatic cancer.
18949742 Cathepsin B, cathepsin H, cathepsin X and cystatin C in sera of patients with early-stage and inflammatory breast cancer.
18760860 2009 Simultaneous expression of Cathepsins B and K in pulmonary adenocarcinomas and squamous cell carcinomas predicts poor recurrence-free and overall survival.
18718938 2008 Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
18714186 2008 Serum cathepsin B and plasma urokinase-type plasminogen activator levels in gastrointestinal tract cancers.
18706099 2008 TCF7L2 gene polymorphisms do not predict susceptibility to diabetes in tropical calcific pancreatitis but may interact with SPINK1 and CTSB mutations in predicting diabetes.
18616803 2008 Tumor marker utility and prognostic relevance of cathepsin B, cathepsin L, urokinase-type plasminogen activator, plasminogen activator inhibitor type-1, CEA and CA 19-9 in colorectal cancer.
18598236 2009 Up-regulation of cathepsin B expression and enhanced secretion in mitochondrial DNA-depleted osteosarcoma cells.
18566436 2008 Cathepsin B is involved in the trafficking of TNF-alpha-containing vesicles to the plasma membrane in macrophages.
18566385 2008 Apoptosis supercedes necrosis in mitochondrial DNA-depleted Jurkat cells by cleavage of receptor-interacting protein and inhibition of lysosomal cathepsin.
18543249 2008 IL-6/sIL-6R enhances cathepsin B and L production via caveolin-1-mediated JNK-AP-1 pathway in human gingival fibroblasts.
18515357 2008 Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
18472965 2008 Cathepsin B mediates the pH-dependent proinvasive activity of tumor-shed microvesicles.
18314113 2009 Imbalanced serum concentration between cathepsin B and cystatin C in patients with pelvic inflammatory disease.
18296264 2008 The expression of matrix metalloproteinase 9 and cathepsin B in gastric carcinoma is associated with lymph node metastasis, but not with postoperative survival.
18163891 2008 Cathepsin V, but not cathepsins L, B and K, may release angiostatin-like fragments from plasminogen.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991740 2008 Cathepsins B, K, and L are regulated by a defined collagen type II peptide via activation of classical protein kinase C and p38 MAP kinase in articular chondrocytes.
17990360 2007 Comprehensive screening for reg1alpha gene rules out association with tropical calcific pancreatitis.
17982689 2007 Cathepsin B is involved in the apoptosis intrinsic pathway induced by Bacillus Calmette-Guérin in transitional cancer cell lines.
17726009 2007 Glycosaminoglycans facilitate procathepsin B activation through disruption of propeptide-mature enzyme interactions.
17724614 2007 cAMP-response element binding protein (CREB) regulates cyclosporine-A-mediated down-regulation of cathepsin B and L synthesis.
17519890 2007 Proteolytic disassembly is a critical determinant for reovirus oncolysis.
17507477 2007 Insulin-like growth factor II receptor-mediated intracellular retention of cathepsin B is essential for transformation of endothelial cells by Kaposi's sarcoma-associated herpesvirus.
17504810 2007 Bacteroides fragilis toxin stimulates intestinal epithelial cell shedding and gamma-secretase-dependent E-cadherin cleavage.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17064696 2006 Sphingosine kinase-1 is cleaved by cathepsin B in vitro: identification of the initial cleavage sites for the protease.
16914553 2006 Cytotoxic T lymphocytes from cathepsin B-deficient mice survive normally in vitro and in vivo after encountering and killing target cells.
16913838 2006 Human cathepsin L rescues the neurodegeneration and lethality in cathepsin B/L double-deficient mice.
16894574 2006 Lipopolysaccharide accelerates caspase-independent but cathepsin B-dependent death of human lung epithelial cells.
16733801 2006 Human homologue of SETA binding protein 1 interacts with cathepsin B and participates in TNF-Induced apoptosis in ovarian cancer cells.
16709808 2006 Function of liver activation-regulated chemokine/CC chemokine ligand 20 is differently affected by cathepsin B and cathepsin D processing.
16534247 2006 Cathepsin B activates human trypsinogen 1 but not proelastase 2 or procarboxypeptidase B.
16492714 2006 Association of cathepsin B gene polymorphisms with tropical calcific pancreatitis.
16381007 2006 Contact of high-invasive, but not low-invasive, melanoma cells to native collagen I induces the release of mature cathepsin B.
16364318 2006 Cathepsin B and its interacting proteins, bikunin and TSRC1, correlate with TNF-induced apoptosis of ovarian cancer cells OV-90.
16315320 2006 Intracellular proteolytic activity of cathepsin B is associated with capillary-like tube formation by endothelial cells in vitro.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16077201 2005 Cathepsins and BID are involved in the molecular switch between apoptosis and autophagy in breast cancer MCF-7 cells exposed to camptothecin.
16051222 2005 Endosomal proteolysis of insulin-like growth factor-I at its C-terminal D-domain by cathepsin B.
16034129 2005 The cathepsin B death pathway contributes to TNF plus IFN-gamma-mediated human endothelial injury.
15832773 Cathepsins B and L and their inhibitors stefin B and cystatin C as markers for malignant progression of benign meningiomas.
15831716 2005 Endosomal proteolysis of the Ebola virus glycoprotein is necessary for infection.
15816632 Immunohistochemical staining of cathepsins B, L and stefin A in human hypophysis and pituitary adenomas.
15807897 2005 The C-terminal subunit of artificially truncated human cathepsin B mediates its nuclear targeting and contributes to cell viability.
15799821 2005 Bone microenvironment modulates expression and activity of cathepsin B in prostate cancer.
15710602 2005 Tumor necrosis factor induces the loss of sphingosine kinase-1 by a cathepsin B-dependent mechanism.
15679122 2004 HaCaT keratinocytes secrete lysosomal cysteine proteinases during migration.
15614436 2005 Human hepatitis B virus X protein promotes cell proliferation and inhibits cell apoptosis through interacting with a serine protease Hepsin.
15512772 2004 Cathepsins B and L increased during response of periodontal ligament cells to mechanical stress in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15274632 2004 Purification and characterization of the human gamma-secretase complex.
15262981 2004 Exon skipping of cathepsin B: mitochondrial targeting of a lysosomal peptidase provokes cell death.
15255544 Comparison of expression of cathepsins B and L and MMP2 in endothelial cells and in capillary sprouting in collagen gel.
15122332 2004 Inhibition of cathepsin B and MMP-9 gene expression in glioblastoma cell line via RNA interference reduces tumor cell invasion, tumor growth and angiogenesis.
15100281 2004 Cathepsin-dependent apoptosis triggered by supraoptimal activation of T lymphocytes: a possible mechanism of high dose tolerance.
15016552 2004 Simultaneous human papilloma virus type 16 E7 and cdk inhibitor p21 expression induces apoptosis and cathepsin B activation.
14984956 2004 The role of cathepsin B and cystatin C in the mechanisms of invasion by ovarian cancer.
14730346 2004 Blockade of cathepsin B expression in human glioblastoma cells is associated with suppression of angiogenesis.
14729603 2004 Cathepsin B mediates caspase-independent cell death induced by microtubule stabilizing agents in non-small cell lung cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14503883 2003 Grafting of features of cystatins C or B into the N-terminal region or second binding loop of cystatin A (stefin A) substantially enhances inhibition of cysteine proteinases.
12926111 Expression, proliferation activity and clinical significance of cathepsin B and cathepsin L in operated lung cancer.
12893746 2003 Cathepsin-B-dependent apoptosis triggered by antithymocyte globulins: a novel mechanism of T-cell depletion.
12887051 2003 Molecular regulation of human cathepsin B: implication in pathologies.
12726991 2003 Cathepsin B in osteoblasts.
12677446 2003 Involvement of cathepsin B in the motor neuron degeneration of amyotrophic lateral sclerosis.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12589965 2003 Cathepsin B and H activities and cystatin C concentrations in cerebrospinal fluid from patients with leptomeningeal metastasis.
12581740 2003 Intracellular and extracellular cathepsin B facilitate invasion of MCF-10A neoT cells through reconstituted extracellular matrix in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437120 Determination of cathepsin B expression may offer additional prognostic information for ovarian cancer patients.
12437117 Modulation of the endosomal and lysosomal distribution of cathepsins B, L and S in human monocytes/macrophages.
12201820 2002 Cathepsin B carboxydipeptidase specificity analysis using internally quenched fluorescent peptides.
12186841 2002 Surface cathepsin B protects cytotoxic lymphocytes from self-destruction after degranulation.
12185082 2002 Cathepsin B mediates tumor necrosis factor-induced arachidonic acid release in tumor cells.
12102727 2002 Cathepsin B cleavage of the trypsinogen activation peptide.
12086583 2002 Cathepsin B expression and down-regulation by gene silencing and antisense DNA in human chondrocytes.
12072442 2002 Interaction of human breast fibroblasts with collagen I increases secretion of procathepsin B.
12057992 2002 In vivo imaging of proteolytic activity in atherosclerosis.
11932257 2002 Presence of cathepsin B in the human pancreatic secretory pathway and its role in trypsinogen activation during hereditary pancreatitis.
11746262 2001 Plasma membrane association of cathepsin B in human prostate cancer: biochemical and immunogold electron microscopic analysis.
11514663 2001 Role of the single cysteine residue, Cys 3, of human and bovine cystatin B (stefin B) in the inhibition of cysteine proteinases.
11513559 2001 A polymorphic marker for the human cathepsin B gene.
11435427 2001 Cathepsin B, L, and S cleave and inactivate secretory leucoprotease inhibitor.
11241311 2001 Expression of cathepsins B and S in the progression of prostate carcinoma.
11228542 Imaging proteolysis by living human breast cancer cells.
11139332 2001 Nuclear localization of cystatin B, the cathepsin inhibitor implicated in myoclonus epilepsy (EPM1).
11134363 2001 Expression patterns of cathepsins B, H, K, L and S in the human endometrium.
11115496 2001 Identification of internal autoproteolytic cleavage sites within the prosegments of recombinant procathepsin B and procathepsin S. Contribution of a plausible unimolecular autoproteolytic event for the processing of zymogens belonging to the papain family.
11016923 2001 Cathepsin B activity regulation. Heparin-like glycosaminogylcans protect human cathepsin B from alkaline pH-induced inactivation.
10876156 2000 Lysosomal cysteine protease, cathepsin B, is targeted to lysosomes by the mannose 6-phosphate-independent pathway in rat hepatocytes: site-specific phosphorylation in oligosaccharides of the proregion.
10849756 2000 Expression of cathepsins B and L in human lung epithelial cells is regulated by cytokines.
10777578 2000 Human procathepsin B interacts with the annexin II tetramer on the surface of tumor cells.
10512713 1999 Cloning and characterization of hurpin (protease inhibitor 13): A new skin-specific, UV-repressible serine proteinase inhibitor of the ovalbumin serpin family.
10395917 1999 Cathepsin expression during skeletal development.
10353845 1999 The contribution of N-terminal region residues of cystatin A (stefin A) to the affinity and kinetics of inhibition of papain, cathepsin B, and cathepsin L.
9928950 1999 Prorenin processing by cathepsin B in vitro and in transfected cells.
9776083 1998 Codistribution of procathepsin B and mature cathepsin B forms in human prostate tumors detected by confocal and immunofluorescence microscopy.
9770500 1998 A novel amplicon at 8p22-23 results in overexpression of cathepsin B in esophageal adenocarcinoma.
9733783 1998 Cystatin F is a glycosylated human low molecular weight cysteine proteinase inhibitor.
9632704 1998 Leukocystatin, a new Class II cystatin expressed selectively by hematopoietic cells.
9585570 1998 The role of Gly-4 of human cystatin A (stefin A) in the binding of target proteinases. Characterization by kinetic and equilibrium methods of the interactions of cystatin A Gly-4 mutants with papain, cathepsin B, and cathepsin L.
9582368 1998 In vivo expression of an alternatively spliced human tumor message that encodes a truncated form of cathepsin B. Subcellular distribution of the truncated enzyme in COS cells.
9539769 1998 Cathepsins B and D are dispensable for major histocompatibility complex class II-mediated antigen presentation.
9412840 Activity and localization of cathepsin B, D and G in aortic aneurysm.
9360997 1997 Elevations in cathepsin B protein content and enzyme activity occur independently of glycosylation during colorectal tumor progression.
9299326 1997 Crystal structure of the wild-type human procathepsin B at 2.5 A resolution reveals the native active site of a papain-like cysteine protease zymogen.
9295331 1997 Identification and characterization of cathepsin B as the cellular MARCKS cleaving enzyme.
9076588 1997 Identification of peptide fragments generated by digestion of bovine and human osteocalcin with the lysosomal proteinases cathepsin B, D, L, H, and S.
8811434 1996 Simultaneous isolation of human kidney cathepsins B, H, L and C and their characterisation.
8635854 1996 Marked increases in cathepsin B and L activities distinguish papillary carcinoma of the thyroid from normal thyroid or thyroid with non-neoplastic disease.
8617355 1996 Crystal structures of human procathepsin B at 3.2 and 3.3 Angstroms resolution reveal an interaction motif between a papain-like cysteine protease and its propeptide.
8612130 1996 Essential role for cathepsin S in MHC class II-associated invariant chain processing and peptide loading.
8112600 1994 Human gastric adenocarcinoma cathepsin B: isolation and sequencing of full-length cDNAs and polymorphisms of the gene.
8083219 1994 Structural and functional characterization of two allelic variants of human cystatin D sharing a characteristic inhibition spectrum against mammalian cysteine proteinases.
8014475 1994 Cathepsin B activity in human lung tumor cell lines: ultrastructural localization, pH sensitivity, and inhibitor status at the cellular level.
7890620 1995 Structural basis for the biological specificity of cystatin C. Identification of leucine 9 in the N-terminal binding region as a selectivity-conferring residue in the inhibition of mammalian cysteine peptidases.
7718586 1995 Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
7622042 1995 Identification of two new exons and multiple transcription start points in the 5'-untranslated region of the human cathepsin-B-encoding gene.
7509303 1994 Human cathepsin B-encoding cDNAs: sequence variations in the 3'-untranslated region.
6351842 1983 Action of human liver cathepsin B on the oxidized insulin B chain.
6203523 1984 The place of human gamma-trace (cystatin C) amongst the cysteine proteinase inhibitors.
3972105 1985 Amino acid sequence of human liver cathepsin B.
3542996 1987 Characterization of pure human renal renin. Evidence for a subunit structure.
3463996 1986 Nucleotide and predicted amino acid sequences of cloned human and mouse preprocathepsin B cDNAs.
3010323 1986 Isolation of a cDNA clone for the human lysosomal proteinase cathepsin B.
2476070 1989 Interaction of lysosomal cysteine proteinases with alpha 2-macroglobulin: conclusive evidence for the endopeptidase activities of cathepsins B and H.
2061332 1991 Identification of renal cathepsin B as a human prorenin-processing enzyme.
1996959 1991 Human cystatin C. role of the N-terminal segment in the inhibition of human cysteine proteinases and in its inactivation by leucocyte elastase.
1984484 1991 Cystatin C and cathepsin B production by alveolar macrophages from smokers and nonsmokers.
1900515 1991 Cathepsin B efficiently activates the soluble and the tumor cell receptor-bound form of the proenzyme urokinase-type plasminogen activator (Pro-uPA).
1868826 1991 The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
1837142 1991 Lysosomal hydrolases of different classes are abnormally distributed in brains of patients with Alzheimer disease.
1645961 1991 Alzheimer's disease amyloid beta-clipping enzyme (APP secretase): identification, purification, and characterization of the enzyme.
1637335 1992 Human tumour cathepsin B. Comparison with normal liver cathepsin B.
1597471 1992 Proprotein conversion is determined by a multiplicity of factors including convertase processing, substrate specificity, and intracellular environment. Cell type-specific processing of human prorenin by the convertase PC1.
1577456 1992 Confirmation of the human cathepsin B gene (CTSB) assignment to chromosome 8.
1326552 1992 The interglobular domain of cartilage aggrecan is cleaved by PUMP, gelatinases, and cathepsin B.
417724 1978 Studies on cathepsin B in human articular cartilage.