Property Summary

Ligand Count 191
NCBI Gene PubMed Count 59
PubMed Score 1162.73
PubTator Score 298.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Neuraminidase deficiency with beta-galactosidase deficiency 1 0.0 0.0
Disease Target Count
Chronic hepatitis C 12
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.700 3.3e-03
astrocytoma 1.700 3.9e-03
Breast cancer 1.200 1.8e-12
glioblastoma 1.500 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.500 5.2e-03
invasive ductal carcinoma 1.074 4.9e-04
ovarian cancer 2.500 2.8e-07
pancreatic cancer 1.400 2.8e-03
primary pancreatic ductal adenocarcinoma 1.156 3.0e-03
subependymal giant cell astrocytoma 1.290 2.0e-02
ulcerative colitis -1.400 1.8e-07

 OMIM Phenotype (1)

PDB (11)

Gene RIF (13)

AA Sequence

MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQ      1 - 70
KDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDK     71 - 140
FYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSS    141 - 210
YEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAP    211 - 280
CAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKAL    281 - 350
NIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKME    351 - 420
VQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY              421 - 480
//

Text Mined References (62)

PMID Year Title