Property Summary

Ligand Count 40
NCBI Gene PubMed Count 38
PubMed Score 293.51
PubTator Score 90.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

AA Sequence

MLGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVL      1 - 70
TAAHCISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVA     71 - 140
CLPEKDSLLPKDYPCYVTGWGRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVIS    141 - 210
ACNGDSGGPLNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL                211 - 268
//

Text Mined References (38)

PMID Year Title