Property Summary

NCBI Gene PubMed Count 33
PubMed Score 282.03
PubTator Score 90.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
27129265 Human anionic trypsinogen is controlled by CTRC in a manner that individual natural mutations are unlikely to increase stability enough to promote intra-pancreatic activation.
26166474 Letter: CTRC intron mutations associated with acute or chronic pancreatitis.
26100556 Mutations in SPINK 1, CFTR and CTRC were detected in 6.3%, 2.3% and 1.8% of patients with acute pancreatitis versus 3.2%, 3.8% and 1.2% of controls. No relationship was found between the detected mutations and severity of pancreatitis.
26022124 Expression of endoplasmic reticulum stress associated CTRC mutants reduces the levels of acetylated tubulin by increasing both the levels and phosphorylation of the deacetylase SIRT2.
26013824 Loss-of-function mutations in CTRC increase the risk for chronic pancreatitis. Describe functional analysis of eight previously uncharacterized natural CTRC variants tested for potential defects in secretion, proteolytic stability, and catalytic activity.
25383785 In Israel, pediatric as well as adult recurrent acute pancreatitis and chronic pancreatitis are often associated with cationic trypsinogen, serine protease inhibitor Kazal type 1, CTRC, or Cystic Fibrosis Transmembrane Conductance Regulator mutations.
25003218 None of the selected 121 pancreatic cancer samples showed a pancreatitis-predisposing mutation in the CTRC gene.
23951356 Rare CTRC genotypes contributed to the development of idiopathic chronic pancreatitis in 4.3% of cases.
23430245 long-range electrostatic attraction toward substrates of concentrated negative charge governs substrate discrimination, which explains CTRC selectivity in regulating active digestive enzyme levels
23135764 In Japanese, 5 novel missense variants in heterozygous form were found in CTRC.
22942235 Chymotrypsin C variants reveals distinct loss-of-function mechanisms associated with chronic pancreatitis risk.
22580415 This study on a large cohort of tropical calcific pancreatitis patients provides evidence of allelic heterogeneity and confirms that CTRC variants play a significant role in its pathogenesis.
22539344 hereditary pancreatitis is caused by CTRC-dependent dysregulation of cationic trypsinogen autoactivation, which results in elevated trypsin levels in the pancreas.
22427236 Frequencies of CFTR variants p.R75Q, p.I148T, 5T-allele and p.E528E were comparable in patients and controls. We identified 103 CFTR variants, which represents a 2.7-fold risk increase (p<0.0001).
21631589 Review: summarize the functional defects associated with CTRC mutations in chronic pancreatitis.
21460362 speculated that chymotrypsin C might regulate pancreatic cancer cell migration in relation to cytokeratin 18 expression
21323990 review of its association with chronic pancreatitis in the Asia Pacific region
21098023 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
20625975 CTRC (p.R254W) mutation might contribute to the panel of mutations that have been reported to elevate pancreatitis susceptibility in primary hyperparathyroidism.
20625975 Observational study of gene-disease association. (HuGE Navigator)
19407484 Novel CTRC gene variations and single nucleotide polymorphisms are associated with chymotrypsin C in a Chinese population.
19407484 Observational study of gene-disease association. (HuGE Navigator)
19404200 The contribution of CTRC variants to tropical calcific pancreatitis (TCP) is relatively small, but the identification of novel loss-of-function variants (p.G61R) underscores the importance of the trypsinogen pathway in causing TCP.
19404200 Observational study of gene-disease association. (HuGE Navigator)
19096130 Observational study of gene-disease association. (HuGE Navigator)
18172691 Observational study of gene-disease association. (HuGE Navigator)
18059268 Observational study of gene-disease association. (HuGE Navigator)
18059268 Study analyzed the gene encoding the trypsin-degrading enzyme chymotrypsin C in German subjects with idiopathic or hereditary chronic pancreatitis; 2 alterations in this gene were significantly overrepresented in the pancreatitis group.
17592142 A key regulator of activation and degradation of cationic trypsin; facilitates trypsinogen activation in the duodenum, and promotes trypsin degradation in the lower intestines as a function of decreasing luminal calcium ion concentrations.

AA Sequence

MLGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVL      1 - 70
TAAHCISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVA     71 - 140
CLPEKDSLLPKDYPCYVTGWGRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVIS    141 - 210
ACNGDSGGPLNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL                211 - 268
//

Text Mined References (33)

PMID Year Title
27129265 2016 Tighter Control by Chymotrypsin C (CTRC) Explains Lack of Association between Human Anionic Trypsinogen and Hereditary Pancreatitis.
26166474 2015 Report of 2 CTRC Intronic Mutations Associated With Acute or Chronic Pancreatitis and Delineation of Their Pathogenic Molecular Mechanisms.
26100556 2015 Genetic mutations in SPINK1, CFTR, CTRC genes in acute pancreatitis.
26022124 2015 ER stress-associated CTRC mutants decrease stimulated pancreatic zymogen secretion through SIRT2-mediated microtubule dysregulation.
26013824 2015 Mesotrypsin Signature Mutation in a Chymotrypsin C (CTRC) Variant Associated with Chronic Pancreatitis.
25416956 2014 A proteome-scale map of the human interactome network.
25383785 2015 Genetic and electrophysiological characteristics of recurrent acute pancreatitis.
25003218 2014 CFTR, SPINK1, PRSS1, and CTRC mutations are not associated with pancreatic cancer in German patients.
23951356 2013 A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.
23430245 2013 Long-range electrostatic complementarity governs substrate recognition by human chymotrypsin C, a key regulator of digestive enzyme activation.
23135764 2013 Identification of novel missense CTRC variants in Japanese patients with chronic pancreatitis.
22942235 2013 Comprehensive functional analysis of chymotrypsin C (CTRC) variants reveals distinct loss-of-function mechanisms associated with pancreatitis risk.
22580415 2013 Comprehensive screening of chymotrypsin C (CTRC) gene in tropical calcific pancreatitis identifies novel variants.
22539344 2012 Increased activation of hereditary pancreatitis-associated human cationic trypsinogen mutants in presence of chymotrypsin C.
22427236 2013 CFTR, SPINK1, CTRC and PRSS1 variants in chronic pancreatitis: is the role of mutated CFTR overestimated?
21631589 2011 Chymotrypsin C mutations in chronic pancreatitis.
21460362 2011 Effect of chymotrypsin C and related proteins on pancreatic cancer cell migration.
21323990 2011 Genetic basis of chronic pancreatitis in Asia Pacific region.
21098023 2011 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
20625975 2011 Multifactorial genesis of pancreatitis in primary hyperparathyroidism: evidence for "protective" (PRSS2) and "destructive" (CTRC) genetic factors.
19407484 2009 Association of novel chymotrypsin C gene variations and haplotypes in patients with chronic pancreatitis in Chinese in Taiwan.
19404200 2009 Tropical calcific pancreatitis and its association with CTRC and SPINK1 (p.N34S) variants.
19096130 2008 Microsatellite scan identifies new candidate genes for susceptibility to alcoholic chronic pancreatitis in Japanese patients.
18172691 2008 Association of rare chymotrypsinogen C (CTRC) gene variations in patients with idiopathic chronic pancreatitis.
18059268 2008 Chymotrypsin C (CTRC) variants that diminish activity or secretion are associated with chronic pancreatitis.
17592142 2007 Chymotrypsin C (caldecrin) promotes degradation of human cationic trypsin: identity with Rinderknecht's enzyme Y.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9538241 1998 Caldecrin is a novel-type serine protease expressed in pancreas, but its homologue, elastase IV, is an artifact during cloning derived from caldecrin gene.
8635596 1996 Molecular cloning and expression of human caldecrin.
2365696 1990 Purification and characterization of catalytic fragments of phosphorylase kinase gamma subunit missing a calmodulin-binding domain.