Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.64
PubTator Score 6.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -5.200 4.5e-10
astrocytoma 1.200 3.6e-25
oligodendroglioma 1.300 6.2e-19
ependymoma 1.100 6.0e-09
glioblastoma 1.400 3.3e-08
sonic hedgehog group medulloblastoma 1.800 1.2e-09
atypical teratoid / rhabdoid tumor 1.600 1.8e-10
medulloblastoma, large-cell 1.500 3.4e-05
primitive neuroectodermal tumor 1.400 1.5e-03
intraductal papillary-mucinous adenoma (... 1.300 9.4e-05
lung cancer 1.200 6.4e-04
pediatric high grade glioma 1.400 2.1e-07
breast carcinoma 1.300 7.4e-26
ileal Crohn's disease -1.078 4.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (3)

PMID Text
21378502 Low CTPS2 expression may be a rationally-based determinant of 5FU resistance.
21252287 CTPS2 was identified by genome-wide gene expression analyses as correlated with cellular sensitivity to cisplatin and carboplatin.
20739275 analysis of the kinetic properties of hCTPS1 and hCTPS2, and determination that Ser(68) is a major site of CTPS2 regulation by phosphorylation

AA Sequence

MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLD      1 - 70
LGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEP     71 - 140
QICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLS    141 - 210
PDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASN    211 - 280
LLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETED    281 - 350
PVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD    351 - 420
STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIK    421 - 490
QFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCK    491 - 560
LSSSDRYSDASDDSFSEPRIAELEIS                                                561 - 586
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378502 2011 Low cytosine triphosphate synthase 2 expression renders resistance to 5-fluorouracil in colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
21252287 2011 Comprehensive evaluation of the contribution of X chromosome genes to platinum sensitivity.
20739275 2010 Regulation of human cytidine triphosphate synthetase 2 by phosphorylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16179339 2005 Expression of Human CTP synthetase in Saccharomyces cerevisiae reveals phosphorylation by protein kinase A.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10899599 2000 Identification of a cDNA encoding an isoform of human CTP synthetase.