Property Summary

NCBI Gene PubMed Count 29
PubMed Score 173.29
PubTator Score 30.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
group 3 medulloblastoma 1.500 5.4e-05
medulloblastoma, large-cell 2.200 3.7e-05
pancreatic ductal adenocarcinoma liver m... -1.549 4.2e-03
non-small cell lung cancer 1.222 1.6e-14
lung cancer 2.200 6.0e-04
psoriasis 1.200 3.4e-143
nasopharyngeal carcinoma 1.300 1.7e-06
Pick disease -1.400 7.4e-06
Breast cancer 1.300 5.1e-10
ductal carcinoma in situ 1.300 7.5e-05
invasive ductal carcinoma 2.000 2.5e-04
ulcerative colitis 1.200 7.4e-06
ovarian cancer 1.800 2.7e-04

 OMIM Phenotype (1)

Gene RIF (8)

PMID Text
24870241 results highlight a key and specific role of CTPS1 in the immune system by its capacity to sustain the proliferation of activated lymphocytes during the immune response
24477477 Rods and rings (RR) are protein assemblies composed of CTPS1 and IMPDH2. Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
23166591 Expression of HIV-1 Tat upregulates the abundance of CTP synthase 1 (CTPS1) in the nucleoli of Jurkat T-cells
20739275 analysis of the kinetic properties of hCTPS1 and hCTPS2, and determination that Ser(68) is a major site of CTPS2 regulation by phosphorylation
18600551 studies provide novel information on the potential interacting proteins that may regulate CTPS1 function or intracellular localization
17681942 analysis of phosphorylation and regulation of human CTPS1 in human cells shows that GSK3 is a novel regulator of CTPS activity
17463002 Data indicate that protein kinase C phosphorylation at Ser(462) stimulates human CTP synthetase 1 activity, whereas phosphorylation at Thr(455) inhibits activity.
16179339 CTP synthetase is phosphorylated by protein kinase A

AA Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLD      1 - 70
LGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEP     71 - 140
QVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLS    141 - 210
PDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRK    211 - 280
MLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEE    281 - 350
PVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN    351 - 420
STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKK    421 - 490
CLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCR    491 - 560
LSPRDTYSDRSGSSSPDSEITELKFPSINHD                                           561 - 591
//

Text Mined References (44)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24870241 2014 CTP synthase 1 deficiency in humans reveals its central role in lymphocyte proliferation.
24477477 2014 Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
24008161 2013 CTP synthase 1, a smooth muscle-sensitive therapeutic target for effective vascular repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22730407 2012 Introduction of a fluorine atom at C3 of 3-deazauridine shifts its antimetabolic activity from inhibition of CTP synthetase to inhibition of orotidylate decarboxylase, an early event in the de novo pyrimidine nucleotide biosynthesis pathway.
22220215 2011 Induction of cytoplasmic rods and rings structures by inhibition of the CTP and GTP synthetic pathway in mammalian cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
20739275 2010 Regulation of human cytidine triphosphate synthetase 2 by phosphorylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18600551 2008 Human cytidine triphosphate synthetase 1 interacting proteins.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
17681942 2007 Regulation of human cytidine triphosphate synthetase 1 by glycogen synthase kinase 3.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17463002 2007 Phosphorylation of human CTP synthetase 1 by protein kinase C: identification of Ser(462) and Thr(455) as major sites of phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17189248 2007 Phosphorylation of human CTP synthetase 1 by protein kinase A: identification of Thr455 as a major site of phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16820675 2006 Structure of the synthetase domain of human CTP synthetase, a target for anticancer therapy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16179339 2005 Expression of Human CTP synthetase in Saccharomyces cerevisiae reveals phosphorylation by protein kinase A.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10064135 1999 Cytidine triphosphate synthase activity and mRNA expression in normal human blood cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7981751 1993 Clustered base substitutions in CTP synthetase conferring drug resistance in Chinese hamster ovary cells.
3355843 1988 Purification of cytidine-triphosphate synthetase from rat liver, and demonstration of monomer, dimer and tetramer.
2113467 1990 Molecular cloning of the human CTP synthetase gene by functional complementation with purified human metaphase chromosomes.
1959918 1991 Chromosome mapping of the human cytidine-5'-triphosphate synthetase (CTPS) gene to band 1p34.1-p34.3 by fluorescence in situ hybridization.
1783378 1991 Genomic organization and chromosomal localization of the human CTP synthetase gene (CTPS).