Property Summary

NCBI Gene PubMed Count 196
PubMed Score 263.78
PubTator Score 360.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (141)

PMID Text
26992637 expression of catenin-delta1 rescued the inhibitory effect of miR-409-3p on cell migration and invasion
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26707622 OGT inhibited the formation of the Ecadherin/catenin complex through reducing the interaction between p120 and Ecadherin.
26477567 Phosphorylation and isoform use in p120-catenin during development and tumorigenesis.
26464646 expression of E-cadherin, and p120 negatively correlated with the tumor differentiation of oral squamous cell carcinoma.
26302406 PLEKHA7 localization to adherens junctions is E-cadherin and p120 dependent.
26097613 p120ctn improves the BBB dysfunction and inflammatory responses induced by LPS through the inhibition of NF-kappaB activation.
26093522 the modulation of HPV-16 E6/E7 expression remarkably influenced cell proliferation, migration, and invasion, as well as the protein levels of E-cadherin and P-cadherin in cervical cell lines.
26067913 Pro-Tumorigenic Phosphorylation of p120 Catenin is associated with Renal and Breast Cancer.
26062780 Survival time of colorectal cancer patients with positive deltacatenin expression was shorter than that of patients with negative deltacatenin expression.
25986488 The expression, redistribution and disassociation of junction proteins in ventilator-induced lung injury were all restored with p120-catenin overexpression.
25807484 uncovering a critical role for CTNND2 in neuronal development and an intimate connection to chromatin biology; data contribute to the understanding of the genetic architecture of autism
25785604 localization of p120 catenin in the cytoplasm rather than the membrane correlates with poor prognosis in esophageal squamous cell carcinoma
25736925 C6orf106 promotes invasion in NSCLC cells. Finally, C6orf106 upregulates vimentin, and downregulates E-cadherin and P120ctn.
25693631 results indicate an anti-inflammatory effect of p120 in bronchial epithelial cells through its modulation of NF-kappaB signaling depending on RhoA/ROCK pathway.
25634213 Enforced expression of miR-29s in gastric cancer cells inhibited cell invasion in vitro and in vivo by directly targeting CTNND1.
25529795 p120ctn down-regulation and EGFR overexpression are able to mimic human ESCC in a culture model
25470111 MiR-145 inhibits invasion of gastric cancer cells not only by down-regulating cytoplasmic catenin-delta1 expression but also by inducing the translocation of catenin-delta1
25273174 We conclude that delta-catenin tends to overexpress in breast carcinoma and promotes the malignant phenotype
25156800 findings confirm that p38 and PAX2 are important for the Dvl-3 induced upregulation of p120ctn
24995336 our study supports the regulatory role of p120 in airway inflammation and reveals that p120 may modulate NF-kappaB signaling partially through RhoA.
24966968 E-cadherin and P120 catenin cocktail immunostain can be used to differentiate ductal carcinoma in situ from lobular carcinoma in situ.
24505377 Transfection of in H1299 cells expressing low p120ctn levels.
24498333 Data indicate that Kaiso protein participates in the regulation of beta-catenin mRNA expression by interacting with p120-catenin in the lung cancer cell lines.
24474278 The optimized knockdown with p120 and Kaiso siRNAs further expands the size of HCEC monolayers without endothelial mesenchymal transition (EMT) via selective activation of p120/Kaiso signaling that requires the RhoA-ROCK-noncanonical BMP-NFkB signaling.
24412473 these results indicate that c-Src can enhance the oncogenic function of delta-catenin in prostate cancer cells
24371222 P120 catenin ARM domains 1, 3-5, and 8 mediate interactions between p120 catenin and MUC1.
24284071 these data suggest that PTP-PEST affects epithelial cell motility by controlling the distribution and phosphorylation of p120 and its availability to control Rho GTPase activity
23981612 Overexpression of HO-1 promotes Caco-2 cell proliferation and migration by targeting the CTNND1 gene.
23936352 expression and subcellular localization of p120-catenin and beta-catenin in oral carcinomas
23887639 Sirolimus-FKBP12.6 impairs endothelial barrier function by activation of protein kinase C-alpha and downstream disruption of the p120-VE cadherin interaction in vascular endothelium.
23839039 Overexpression of NLBP promotes the cell proliferation of lung adenocarcinoma through interacting with p120ctn.
23706919 p120ctn delocalization/loss of expression could be an independent prognostic marker in oral squamous cell carcinoma
23653363 Data indicate a role for p120-catenin (amino acids 820-843) domain in the p120-catenin.p190RhoGAP signaling complex assembly and membrane targeting.
23614500 FoxC2 and p120ctn play important roles in the progression and prognosis of gastric cancer.
23499891 study demonstrated miR-145 targeted catenin delta-1, contributing to aberrant translocation of beta-catenin through impaired nuclear shuttling with p21-activated kinase 4; findings uncover a novel role of miR-145 in modulating intracellular translocation of beta-catenin on Wnt/beta-catenin signaling pathway
23423910 Overexpression of delta-catenin reduces the expression of E-cadherin and alters the balance between E-cadherin and p120ctn, which in turn affects the formation of intercellular adhesions and promotes invasion and metastasis in Colorectal cancer.
23325790 the binding of VE-cadherin to p120 regulates adhesive contact area in a Rac1-dependent manner
23220088 prostate cancer CWR22Rv-1 cells overexpressing delta-catenin display bigger tumor formation and higher angiogenic potentials than their matched control cells in the CAM assay.
23212915 Neural Wiskott-Aldrich syndrome protein (N-WASP)-mediated p120-catenin interaction with Arp2-Actin complex stabilizes endothelial adherens junctions.
23139153 Suggest pivotal role of miR-197 in the regulation of p120 catenin in invasive ductal adenocarcinoma.
23073801 P120ctn plays a pivotal role in the proliferation.
23071156 results reveal the mechanistic basis by which p120 stabilizes cadherins and demonstrate that VE-cadherin endocytosis is crucial for endothelial cell migration in response to an angiogenic growth factor.
22846708 FRMD5 may play a role in p120-catenin-based cell-cell contact and is involved in the regulation of tumor progression
22833523 Identify MUC1-CT and p120ctn as important regulators of epithelial polarity and cell-cell adhesion during a smoke-induced epithelial mesenchymal transition-like process.
22833212 High cytoplasmic p120ctn expression is associated with thymoma.
22777005 S-nitrosation correlated with diminished abundance of beta-catenin and p120 at the adherens junction and with hyperpermeability.
22648953 p120 overexpression inhibits neutrophil migration independently of an effect on RhoA or Rac and instead blocks migration by preventing VE-cadherin tyrosine phosphorylation and association of active Src with the VE-cadherin complex
22615871 P120ctn isoform 3A increased the invasiveness in all four cell lines.
22590627 Selective activation of p120ctn-Kaiso signaling to unlock contact inhibition of ARPE-19 cells without epithelial-mesenchymal transition.
22583808 This review summarizes the current findings about the influence of Rho GTPases on the formation and maintenance of adherens junction and discusses the involvement of p120 catenin on cell-cell adhesion and tumor cell migration. [review]
22513089 Activation of E-cadherin induces p120-catenin dephosphorylation, as well as changes in the cadherin cytoplasmic domain.
22276175 Results suggest that p120ctn isoforms 1 and 3 up-regulate cyclin D1, and thereby cyclin E, resulting in the promotion of cell proliferation and cell cycle progression in lung cancer cells.
22120634 These data suggested that smoke-induced cell migration was mediated via an EGFR/Src-dependent signaling pathway in cells that expressed p120ctn, but upon loss of p120ctn, migration continued to occur via an alternative, EGFR/Src-independent pathway.
22031287 p120 dynamically regulates Rho-GTPase activity at the E-cadherin complex through transient interaction with several of its up- and downstream effectors, including ROCK1
22022388 Dynamin 2/NPRAP colocalization and direct interaction in vivo, was investigated.
21937720 study presents evidence that in the cadherin-catenin complex alpha-catenin contributes to the binding strength of another catenin, p120, to the same complex; data suggest alpha-catenin-p120 contact within the cadherin-catenin complex can regulate cadherin trafficking
21775625 we found that Numb directly interacted with p120 catenin, which is known to interact with E-cadherin and prevent its internalization
21747168 p120-catenin regulates growth of metastatic lobular carcinoma through Rock1-mediated anoikis resistance
21732359 Results demonstrate a role for afadin in the regulation of vascular barrier function via coordination of adherens junction-tight junction and p120-catenin-ZO-1 interactions.
21670201 when released from E-cadherin by Wnt3a-stimulated phosphorylation, p120-catenin controls the activity of Kaiso, enhancing its binding to repressed promoters and relieving its inhibition of the beta-catenin-Tcf-4 transcriptional complex.
21554891 p120ctn functions to suppress transcription, which is an important and novel regulation in vascular endothelium
21481789 p120ctn Expression Is Lost or Reduced in Esophageal Cancer Tissues and Cell Linessuppressor gene.
21468542 p120-catenin isoform 3 regulates the nuclear export of Kaiso and promotes invasion in lung cancer cells via a phosphorylation-dependent mechanism.
21385933 the TGF-beta and p120-associated noncanonical beta-catenin pathways are important in pelvic lymph node metastasis in early-stage cervical cancer
21336985 The data provide evidence for the role of c-Crk proto-oncogene in transcriptional repression of p120ctn that further clarifies the mechanism by which this biochemical signal promotes metastasis in non-small cell lung cancer.
21317933 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21098636 The degradation machinery of the canonical Wnt pathway modulates p120-catenin protein stability through mechanisms shared with those regulating beta-catenin.
21070476 Increased delta-catenin expression is critical for maintenance of the malignant phenotype of lung cancer, making delta-catenin a candidate target protein for future cancer therapeutics.
20971762 p120 is required for maintaining VE-cadherin expression and transendothelial resistance independently of its NH(2) terminus and its role in regulating Rho.
20940130 Results demonstrate a novel and crucial function of p120-catenin in Wnt signaling and unveil additional points of regulation by this factor of beta-catenin transcriptional activity different of beta-catenin stability.
20668551 Data indicate that depletion of any of the cadherin-associated proteins, p120ctn, beta-catenin or alpha-catenin, is sufficient to disrupt adherens junctions in DU145 cells and increase migration and cancer cell invasion.
20599710 These results suggest that the transient increase of cytoplasmic p120-catenin may stimulate RhoGTPase activities and act as a switch for the morphological changes in ECs in response to shear stress.
20564219 Data show that both Pak5 and constitutively active Pak4, the founding member of the Group B Paks, directly phosphorylate p120 in vitro.
20510078 Different expression patterns of E-cadherin and p120-catenin proteins can be helpful to distinguish infiltrating lobular carcinoma from ductal carcinoma of the breast.
20460685 Reduced p120ctn promoter activity, protein level, and mRNA message is found in lung cancer cells compared with noncancerous immortalized lung epithelial cells.
20382170 In endothelial cells, p120ctn has a transcription repression function through regulation of Kaiso, possibly as a cofactor with the transcription factor.
20371349 Study presents the crystal structure of p120 isoform 4A in complex with the JMD core region (JMD(core)) of E-cadherin.
20232357 Knockdown of HDPR1 gene enhanced the invasive ability of lung cancer cells, which was dependent on p120ctn and independent of beta-catenin
20193553 Polymorphism of P120 catenin gene at T755G might be a risk factor for pancreatic carcinoma.
20172018 These results indicate an anti-inflammatory effect of p120 in bronchial epithelial cells, through its modulation of NF-kappaB signaling.
20151151 The altered expression of p120catenin isoforms in invasive breast cancer and, in our material, the decrease in p120 immunoexpression was significantly associated with poor outcome of disease.
20118984 cadherin switching and p120(ctn) signaling as important targets of GnRH function and as novel mediators of invasiveness and tumor progression in ovarian cancer.
20108168 Cells overexpressing delta-catenin have less p120-catenin than control cells at the cell-cell interface, causing the relocalization of p120-catenin from the plasma membrane to the cytosol. CTNND1 binding to E-cadherin adversely affects CTNND2 stability.
19894558 The abnormal expression of E-cadherin and P(120ctn) is closely related to the degree of differentiation, clinical stage and cervical lymph node metastasis in nasopharyngeal carcinoma.
19763914 In lung cancer, p120ctn isoform 1 over-expression correlated positively with lymph node metastasis, poor differentiation, histological type, & high TNM stage. Expression in metastases was always higher than in the primary tumor.
19711372 pH 6.6 activates Src kinases, resulting in tyrosine phosphorylation of E-cadherin and p120ctn and a weakening of the association of E-cadherin with p120ctn and contributing to the instability of E-cadherin at adherens junctions
19706605 GSK-3 interacts with and phosphorylates delta-catenin and thereby negatively affects its stability by enabling its ubiquitination/proteosome-mediated proteolysis
19615783 p120ctn and Kaiso might co-participate in the progression and lymph node metastasis of lung cancer
19604117 Using in vitro infection assays, the authors showed that Helicobacter pylori CagA interacts with E-cadherin, p120-catenin, and c-Met.
19293150 p190RhoGAP and p120ctn associated predominantly on the plasma membrane of cells overexpressing E-cadherin, and that E-cadherin-bound p120ctn contributed to RhoA inactivation by favoring p190RhoGAP-RhoA association.
19284555 At least one consequence of an increased expression of delta-catenin in human prostate cancer is the alteration of cell cycle and survival gene profiles, thereby promoting tumor progression.
19162367 Abnormal p120-catenin expression correlates with abnormal E-cadherin expression and specific small GTPase overexpression, which contribute to the malignancy-related to NSCLC.
19154401 p120-catenin gene knockdown enhances the metastasis of lung cancer cells
19150613 p120ctn isoforms 1A and 3A differently regulated the adhesive, proliferative, and invasive properties of lung cancer cells through distinct mechanisms.
19116988 The extracellular accumulation of delta-catenin in urine supporting its potential utility for non-invasive prostate cancer detection.
19008223 p120ctn is a unique positive regulator of the gamma-secretase processing of cadherins and a negative regulator of the amyloid precursor protein processing
18979298 VE-cadherin levels are not directly related to N-cadherin levels but may be inversely related due to competition for p120.
18950621 PDGFR-mediated phosphorylation at this site is dependent on PKCalpha, a conventional PKC isoform implicated previously in disruption of adherens junctions.
18837082 Reduced expression of E-cadherin/catenin complex in hepatocellular carcinomas.
18653469 p120 and Kaiso regulate Helicobacter pylori-induced expression of matrix metalloproteinase-7
18641366 VE-cad gap formation is required for leukocyte transmigration and identify p120 as a critical intracellular mediator of this process through its regulation of VE-cad expression at junctions.
18632982 p120-catenin is a key component of the cadherin-gamma-secretase supercomplex
18595142 Reduced expression of P120 catenin in cholangiocarcinoma correlated with tumor clinicopathologic parameters.
18550473 p120 expression in solid pseudopapillary tumors (SPTs) is abnormal. Loss of E-cadherin is probably consequent on p120 loss or decrease. Aberrations & other alterations of the E-cadherin gene are unlikely to be responsible for loss of E-cadherin in SPTs.
18490349 Report nuclear targeting of beta-catenin and p120ctn during thrombin-induced endothelial barrier dysfunction.
18407999 the the increased expression of p120 isoform 1 during tumor progression contributes to the invasive phenotype of cadherin-deficient carcinomas and that the N-terminal domain of p120 is a valid therapeutic target
18343367 findings show that p120ctn is a novel interactor of the desmoglein proteins, and may play a role in desmosome remodeling
18032823 The expression of p120-catenin isoforms was associated with the genomic and transcriptional phenotype of breast cancer cells.
17719574 These data suggest that serine/threonine phosphorylation of p120 influences the dynamics of E-cadherin in junctions.
17668445 We show that a fraction of N-cadherin in a complex with catenins is associated with cholesterol/sphingolipid-rich membrane microdomains in aggressive melanoma cells in vitro and experimental melanomas in vivo.
17576929 Cortactin and p120 are shown to directly interact with each other via the cortactin N-terminal region
17509776 Helicobacter pylori infected gastric epithelial cells showed altered distribution/phosphorylation of p120ctn.
17383052 P120CTN was expressed stongly on the cuboidal cell membrane and cytoplasm of both tumor types. In polygonal cells, expression was decreased and mostly cytoplasmic.
17344476 identification of Gli-similar 2 (Glis2) as a novel binding protein for p120 catenin
17334396 membranous p120 is maintained in invasive squamous cell carcinomas in tumours suggesting that p120 may be important for the collective invasion of tumours cells in vivo
17264675 In this review, p120 catenins function in the cytoplasm as versatile scaffolds that confer specificity to the complex regulation of Rho-GTPases and direct the spatio-temporal control of Rho-signalling.
17242406 the recruitment of PI3K to the E-cadherin/beta-catenin/p120-catenin complex via beta-catenin at the plasma membrane is required for calcium-induced phospholipase C-gamma1 activation and, ultimately, keratinocyte differentiation
16982802 p120 catenin and mesenchymal cadherins are both required for invasiveness of E-cadherin-deficient cells; p120 acts as a rheostat, promoting a sessile cell phenotype associated with E-cadherin or a motile phenotype associated with mesenchymal cadherins.
16935280 Membrane-localization and not cadherin interaction is the main determinant in p120 serine-threonine phosphorylation-dephosphorylation, further, the phospho-status had no effect on p120's role in cadherin complex stabilization or cell-cell adhesion.
16786001 the degradation of E-cadherin in response to expression of R-cadherin is due to competition for p120(ctn)
16534869 results indicate that p120ctn plays an important role in regulating the formation of E-cadherin and -catenin complex, cell apoptosis, cell cycle and hepatoma cell biological function
16226102 Increased expression of delta-catenin is associated with the down-regulation and redistribution of ECAD and p120ctn in prostatic cancer.
16120645 These results support a model in which the VE-cadherin tail mediates interactions with clathrin-dependent endocytic machinery, and this endocytic processing is inhibited by p120 binding to the cadherin tail.
15857834 trans-interacting nectin inhibits non-trans-interacting E-cadherin endocytosis through afadin, Rap1, and p120ctn
15833838 Overexpression of P-cadherin was strongly associated with cytoplasmic accumulation of one of the catenins, p120ctn, and cadherin switching in pancreatic ductal carcinoma cells.
15817151 Catenin p120ctn inhibits association of Kaiso with the matrilysin promoter.
15561585 E-cadherin-deficiency in metastatic cancer may in some cases be due to p120 downregulation [review]
15522875 in human lymphoblasts, the silencing of one allele is incomplete
15240885 Galpha12-p120ctn interaction acts as a molecular switch, which regulates cadherin-mediated cell-cell adhesion.
15161659 Cytoplasmic p120ctn may contribute to the invasive phenotype of E-cadherin-deficient breast cancer cells
14699141 differential expression of p120(ctn) and Kaiso mRNA was observed in human coronary artery endothelial cells depending on how laminar shear stress was applied in relation to the wounding process
14660598 binding of p120ctn to microtubules is inversely related to its ability to regulate Rho GTPases
14610056 Cellular levels of p120ctn function as a set point mechanism that regulates cadherin expression levels; a major function of p120ctn is to control cadherin internalization and degradation.
14610055 The data reveal a core function of p120 in cadherin complexes, and strongly predict a dose-dependent loss of E-cadherin in tumors that partially or completely down-regulate p120.
12740216 study links posttranslational modifications of VEC, beta-catenin, and p120 to the mechanism of thrombin-induced increase in endothelial permeability
12671892 Both p120(ctn)-defective tumor cell contacts and p120(ctn)-mediated growth signals appear to contribute to the aggressive spread of pancreatic cancer.
12492499 roles of p120 as a tumor suppressor or metastasis promoter are discussed (review)
12427869 These data reveal a cooperative interaction between p120 catenin and E-cadherin and a novel role for p120 that is likely indispensable in normal cells.
12115574 Overexpression of delta catenin is associated with prostatic adenocarcinoma
11855855 The interaction of VE-cadherin with p120 catenin plays an important role in cellular growth, suggesting that the binding of p120 catenin to cadherins may regulate cell proliferation.

AA Sequence

MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFV      1 - 70
GDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETT     71 - 140
VKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPP    141 - 210
DGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPY    211 - 280
GLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASL    281 - 350
DSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP    351 - 420
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIV    421 - 490
DHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF    491 - 560
IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS    561 - 630
RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGR    631 - 700
YIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNF    701 - 770
SEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE    771 - 840
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNER    841 - 910
GDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI                911 - 968
//

Text Mined References (214)

PMID Year Title
26992637 2016 MicroRNA-409-3p inhibits osteosarcoma cell migration and invasion by targeting catenin-?1.
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26707622 2016 Inhibition of E-cadherin/catenin complex formation by O-linked N-acetylglucosamine transferase is partially independent of its catalytic activity.
26477567 2016 Phosphorylation and isoform use in p120-catenin during development and tumorigenesis.
26464646 2015 Reduced expression of E-cadherin and p120-catenin and elevated expression of PLC-?1 and PIKE are associated with aggressiveness of oral squamous cell carcinoma.
26302406 2015 Distinct E-cadherin-based complexes regulate cell behaviour through miRNA processing or Src and p120 catenin activity.
26097613 2015 P120 catenin attenuates lipopolysaccharide-induced blood-brain barrier dysfunction and inflammatory responses in human brain microvascular endothelial cells.
26093522 2015 HPV-16 E6/E7 promotes cell migration and invasion in cervical cancer via regulating cadherin switch in vitro and in vivo.
26067913 2015 Pro-Tumorigenic Phosphorylation of p120 Catenin in Renal and Breast Cancer.
26062780 2015 Overexpression of ?-catenin is associated with a malignant phenotype and poor prognosis in colorectal cancer.
25986488 2015 Protective role of p120-catenin in maintaining the integrity of adherens and tight junctions in ventilator-induced lung injury.
25807484 2015 Loss of ?-catenin function in severe autism.
25785604 2015 Altered localization of p120 catenin in the cytoplasm rather than the membrane correlates with poor prognosis in esophageal squamous cell carcinoma.
25736925 2015 C6orf106 enhances NSCLC cell invasion by upregulating vimentin, and downregulating E-cadherin and P120ctn.
25693631 p120-Catenin modulating nuclear factor-?B activation is partially RhoA/ROCKdependent in scratch injury.
25634213 2015 Chemotherapy-Induced miRNA-29c/Catenin-? Signaling Suppresses Metastasis in Gastric Cancer.
25529795 2015 p120-catenin down-regulation and epidermal growth factor receptor overexpression results in a transformed epithelium that mimics esophageal squamous cell carcinoma.
25470111 2015 Catenin-?1, negatively regulated by miR-145, promotes tumour aggressiveness in gastric cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25273174 2015 ?-catenin promotes the malignant phenotype in breast cancer.
25156800 2015 Dishevelled-3 activates p65 to upregulate p120-catenin transcription via a p38-dependent pathway in non-small cell lung cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24995336 2014 p120 modulates LPS-induced NF-?B activation partially through RhoA in bronchial epithelial cells.
24966968 2014 Diagnostic utility of E-cadherin and P120 catenin cocktail immunostain in distinguishing DCIS from LCIS.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24505377 2014 Impact of p120-catenin isoforms 1A and 3A on epithelial mesenchymal transition of lung cancer cells expressing E-cadherin in different subcellular locations.
24498333 2014 Kaiso interacts with p120-catenin to regulate ?-catenin expression at the transcriptional level.
24474278 2014 Knockdown of both p120 catenin and Kaiso promotes expansion of human corneal endothelial monolayers via RhoA-ROCK-noncanonical BMP-NF?B pathway.
24412473 2014 C-Src-mediated phosphorylation of ?-catenin increases its protein stability and the ability of inducing nuclear distribution of ?-catenin.
24371222 2014 Interactions between MUC1 and p120 catenin regulate dynamic features of cell adhesion, motility, and metastasis.
24284071 2014 PTP-PEST targets a novel tyrosine site in p120 catenin to control epithelial cell motility and Rho GTPase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
23981612 2013 Heme oxygenase-1 promotes Caco-2 cell proliferation and migration by targeting CTNND1.
23936352 2013 Concomitant loss of p120-catenin and ?-catenin membrane expression and oral carcinoma progression with E-cadherin reduction.
23887639 2013 Sirolimus-FKBP12.6 impairs endothelial barrier function through protein kinase C-? activation and disruption of the p120-vascular endothelial cadherin interaction.
23839039 2013 Overexpression of a novel regulator of p120 catenin, NLBP, promotes lung adenocarcinoma proliferation.
23706919 2013 Is expression of p120ctn in oral squamous cell carcinomas a prognostic factor?
23653363 2013 Interaction of p190RhoGAP with C-terminal domain of p120-catenin modulates endothelial cytoskeleton and permeability.
23614500 2013 The clinical significance of mesenchyme forkhead 1 (FoxC2) in gastric carcinoma.
23499891 2013 Tumor-suppressive microRNA-145 targets catenin ?-1 to regulate Wnt/?-catenin signaling in human colon cancer cells.
23423910 2014 Delta-catenin promotes the proliferation and invasion of colorectal cancer cells by binding to E-cadherin in a competitive manner with p120 catenin.
23325790 2013 p120-catenin and ?-catenin differentially regulate cadherin adhesive function.
23220088 2013 ?-Catenin overexpression promotes angiogenic potential of CWR22Rv-1 prostate cancer cells via HIF-1? and VEGF.
23212915 2013 Neural Wiskott-Aldrich syndrome protein (N-WASP)-mediated p120-catenin interaction with Arp2-Actin complex stabilizes endothelial adherens junctions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139153 2013 miR-197 induces epithelial-mesenchymal transition in pancreatic cancer cells by targeting p120 catenin.
23073801 2012 Effect of p120 catenin silencing on biological behaviors of PANC-1 cells.
23071156 2012 p120-catenin binding masks an endocytic signal conserved in classical cadherins.
22846708 2012 FERM-containing protein FRMD5 is a p120-catenin interacting protein that regulates tumor progression.
22833523 2013 Cigarette smoke disrupts the integrity of airway adherens junctions through the aberrant interaction of p120-catenin with the cytoplasmic tail of MUC1.
22833212 2012 Expression of P120 catenin, Kaiso, and metastasis tumor antigen-2 in thymomas.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22777005 2012 S-Nitrosation of ?-catenin and p120 catenin: a novel regulatory mechanism in endothelial hyperpermeability.
22648953 2012 p120-Catenin prevents neutrophil transmigration independently of RhoA inhibition by impairing Src dependent VE-cadherin phosphorylation.
22615871 2012 N-terminal 1-54 amino acid sequence and Armadillo repeat domain are indispensable for P120-catenin isoform 1A in regulating E-cadherin.
22590627 2012 Selective activation of p120ctn-Kaiso signaling to unlock contact inhibition of ARPE-19 cells without epithelial-mesenchymal transition.
22583808 2012 Regulation of adherens junctions by Rho GTPases and p120-catenin.
22513089 2012 Conformational epitopes at cadherin calcium-binding sites and p120-catenin phosphorylation regulate cell adhesion.
22276175 2012 P120-catenin isoforms 1 and 3 regulate proliferation and cell cycle of lung cancer cells via ?-catenin and Kaiso respectively.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22120634 2012 p120-catenin modulates airway epithelial cell migration induced by cigarette smoke.
22031287 2012 Association of Rho-associated protein kinase 1 with E-cadherin complexes is mediated by p120-catenin.
22022388 2011 Identification of novel NPRAP/?-catenin-interacting proteins and the direct association of NPRAP with dynamin 2.
21937720 2011 ?-Catenin contributes to the strength of E-cadherin-p120 interactions.
21775625 2011 Numb controls E-cadherin endocytosis through p120 catenin with aPKC.
21747168 2011 Cytosolic p120-catenin regulates growth of metastatic lobular carcinoma through Rock1-mediated anoikis resistance.
21732359 2012 Afadin controls p120-catenin-ZO-1 interactions leading to endothelial barrier enhancement by oxidized phospholipids.
21670201 2011 Wnt controls the transcriptional activity of Kaiso through CK1?-dependent phosphorylation of p120-catenin.
21554891 2011 Loss of p120 catenin upregulates transcription of pro-inflammatory adhesion molecules in human endothelial cells.
21481789 2011 Deletion of p120-catenin results in a tumor microenvironment with inflammation and cancer that establishes it as a tumor suppressor gene.
21468542 2011 p120-catenin isoform 3 regulates subcellular localization of Kaiso and promotes invasion in lung cancer cells via a phosphorylation-dependent mechanism.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385933 2011 Involvement of the TGF-beta and beta-catenin pathways in pelvic lymph node metastasis in early-stage cervical cancer.
21336985 2011 c-Crk proto-oncogene contributes to transcriptional repression of p120-catenin in non-small cell lung cancer cells.
21317933 2011 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21269460 2011 Initial characterization of the human central proteome.
21098636 2010 Shared molecular mechanisms regulate multiple catenin proteins: canonical Wnt signals and components modulate p120-catenin isoform-1 and additional p120 subfamily members.
21070476 2011 Upregulation of ?-catenin is associated with poor prognosis and enhances transcriptional activity through Kaiso in non-small-cell lung cancer.
20971762 2011 p120 regulates endothelial permeability independently of its NH2 terminus and Rho binding.
20940130 2010 A p120-catenin-CK1epsilon complex regulates Wnt signaling.
20668551 2010 p120ctn and P-cadherin but not E-cadherin regulate cell motility and invasion of DU145 prostate cancer cells.
20599710 2010 Role of p120-catenin in the morphological changes of endothelial cells exposed to fluid shear stress.
20564219 2010 p120-catenin is a binding partner and substrate for Group B Pak kinases.
20510078 2010 [Expression pattern of E-cadherin and p120-catenin in infiltrating lobular carcinoma and ductal carcinoma of the breast and its significance].
20460685 2010 p120-catenin is transcriptionally downregulated by FOXC2 in non-small cell lung cancer cells.
20382170 2010 P120 catenin represses transcriptional activity through Kaiso in endothelial cells.
20371349 2010 Dynamic and static interactions between p120 catenin and E-cadherin regulate the stability of cell-cell adhesion.
20232357 2010 Downregulation of HDPR1 is associated with poor prognosis and affects expression levels of p120-catenin and beta-catenin in nonsmall cell lung cancer.
20193553 2009 [The expression of P120 catenin in pancreatic carcinoma and the relationship between the T755G polymorphism of P120 catenin gene and pancreatic carcinoma].
20172018 2010 Involvement of p120 in LPS-induced NF-kappaB activation and IL-8 production in human bronchial epithelial cells.
20151151 2010 Altered expression of p120catenin predicts poor outcome in invasive breast cancer.
20123964 2010 Lipid phosphate phosphatase 3 stabilization of beta-catenin induces endothelial cell migration and formation of branching point structures.
20118984 2010 Cadherin switching and activation of p120 catenin signaling are mediators of gonadotropin-releasing hormone to promote tumor cell migration and invasion in ovarian cancer.
20108168 2010 Delta-catenin affects the localization and stability of p120-catenin by competitively interacting with E-cadherin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19894558 2009 [Expression of E-cadherin and P(120ctn) in nasopharyngeal carcinoma and their relationship].
19763914 2010 p120ctn isoform 1 expression significantly correlates with abnormal expression of E-cadherin and poor survival of lung cancer patients.
19711372 2009 An acidic extracellular pH disrupts adherens junctions in HepG2 cells by Src kinases-dependent modification of E-cadherin.
19706605 2009 GSK-3 phosphorylates delta-catenin and negatively regulates its stability via ubiquitination/proteosome-mediated proteolysis.
19615783 2010 Kaiso is expressed in lung cancer: its expression and localization is affected by p120ctn.
19604117 2009 CagA associates with c-Met, E-cadherin, and p120-catenin in a multiproteic complex that suppresses Helicobacter pylori-induced cell-invasive phenotype.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19332538 2009 Density-enhanced phosphatase 1 regulates phosphorylation of tight junction proteins and enhances barrier function of epithelial cells.
19293150 2009 Overexpression of E-cadherin on melanoma cells inhibits chemokine-promoted invasion involving p190RhoGAP/p120ctn-dependent inactivation of RhoA.
19284555 2009 delta-Catenin promotes prostate cancer cell growth and progression by altering cell cycle and survival gene profiles.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19162367 2009 Abnormal expression of p120-catenin, E-cadherin, and small GTPases is significantly associated with malignant phenotype of human lung cancer.
19154401 2009 Ablation of p120-catenin enhances invasion and metastasis of human lung cancer cells.
19150613 2009 P120-catenin isoforms 1A and 3A differently affect invasion and proliferation of lung cancer cells.
19116988 2009 Identification of extracellular delta-catenin accumulation for prostate cancer detection.
19008223 2009 p120 catenin recruits cadherins to gamma-secretase and inhibits production of Abeta peptide.
18979298 2008 N-cadherin levels in endothelial cells are regulated by monolayer maturity and p120 availability.
18950621 2009 PDGF receptor activation induces p120-catenin phosphorylation at serine 879 via a PKCalpha-dependent pathway.
18837082 2008 Reduced expression of E-cadherin/catenin complex in hepatocellular carcinomas.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18653469 2008 p120 and Kaiso regulate Helicobacter pylori-induced expression of matrix metalloproteinase-7.
18641366 2008 p120-Catenin regulates leukocyte transmigration through an effect on VE-cadherin phosphorylation.
18632982 2008 p120-catenin is a key component of the cadherin-gamma-secretase supercomplex.
18595142 2008 Reduced expression of P120 catenin in cholangiocarcinoma correlated with tumor clinicopathologic parameters.
18550473 2008 p120 catenin reduction and cytoplasmic relocalization leads to dysregulation of E-cadherin in solid pseudopapillary tumors of the pancreas.
18490349 2008 Nuclear targeting of beta-catenin and p120ctn during thrombin-induced endothelial barrier dysfunction.
18407999 2008 A p120 catenin isoform switch affects Rho activity, induces tumor cell invasion, and predicts metastatic disease.
18343367 2008 P120-catenin is a novel desmoglein 3 interacting partner: identification of the p120-catenin association site of desmoglein 3.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18032823 2007 Expression of p120-catenin isoforms correlates with genomic and transcriptional phenotype of breast cancer cell lines.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17719574 2008 The regulatory or phosphorylation domain of p120 catenin controls E-cadherin dynamics at the plasma membrane.
17668445 2008 Compartmentalization in membrane rafts defines a pool of N-cadherin associated with catenins and not engaged in cell-cell junctions in melanoma cells.
17576929 2007 p120 catenin regulates lamellipodial dynamics and cell adhesion in cooperation with cortactin.
17509776 2007 Helicobacter pylori alters the distribution of ZO-1 and p120ctn in primary human gastric epithelial cells.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17383052 2007 Expression of E-cadherin, beta-catenin and p120ctn in the pulmonary sclerosing hemangioma.
17344476 2007 The transcriptional repressor Glis2 is a novel binding partner for p120 catenin.
17334396 2007 p120-catenin is required for the collective invasion of squamous cell carcinoma cells via a phosphorylation-independent mechanism.
17264675 2007 Beyond regulation of cell adhesion: local control of RhoA at the cleavage furrow by the p0071 catenin.
17242406 2007 The recruitment of phosphatidylinositol 3-kinase to the E-cadherin-catenin complex at the plasma membrane is required for calcium-induced phospholipase C-gamma1 activation and human keratinocyte differentiation.
17194753 2007 Specific phosphorylation of p120-catenin regulatory domain differently modulates its binding to RhoA.
17115030 2006 The armadillo protein p0071 regulates Rho signalling during cytokinesis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17047063 2006 E-cadherin regulates human Nanos1, which interacts with p120ctn and induces tumor cell migration and invasion.
16982802 2006 p120 catenin is essential for mesenchymal cadherin-mediated regulation of cell motility and invasiveness.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16935280 2006 p120 serine and threonine phosphorylation is controlled by multiple ligand-receptor pathways but not cadherin ligation.
16786001 2006 Expression of inappropriate cadherins by epithelial tumor cells promotes endocytosis and degradation of E-cadherin via competition for p120(ctn).
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16534869 2006 P120ctn overexpression enhances beta-catenin-E-cadherin binding and down regulates expression of survivin and cyclin D1 in BEL-7404 hepatoma cells.
16354688 2006 A family of human zinc finger proteins that bind methylated DNA and repress transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16226102 2005 Increased expression of delta-catenin/neural plakophilin-related armadillo protein is associated with the down-regulation and redistribution of E-cadherin and p120ctn in human prostate cancer.
16212419 Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC).
16120645 2005 p120-Catenin regulates clathrin-dependent endocytosis of VE-cadherin.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15857834 2005 Regulation of E-cadherin endocytosis by nectin through afadin, Rap1, and p120ctn.
15833838 2005 Overexpressed P-cadherin/CDH3 promotes motility of pancreatic cancer cells by interacting with p120ctn and activating rho-family GTPases.
15817151 2005 The catenin p120ctn inhibits Kaiso-mediated transcriptional repression of the beta-catenin/TCF target gene matrilysin.
15657067 2005 Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15561585 2004 Regulation of cadherin stability and turnover by p120ctn: implications in disease and cancer.
15522875 2005 Monoallelic expression and asynchronous replication of p120 catenin in mouse and human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15240885 2004 A role for Galpha12/Galpha13 in p120ctn regulation.
15166316 2004 Dissection of the mammalian midbody proteome reveals conserved cytokinesis mechanisms.
15161659 2004 Cytoplasmic p120ctn regulates the invasive phenotypes of E-cadherin-deficient breast cancer.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14996911 2004 EGFR signaling to p120-catenin through phosphorylation at Y228.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699141 2004 Laminar shear stress differentially modulates gene expression of p120 catenin, Kaiso transcription factor, and vascular endothelial cadherin in human coronary artery endothelial cells.
14660598 2004 p120 catenin associates with microtubules: inverse relationship between microtubule binding and Rho GTPase regulation.
14610056 2003 Cellular levels of p120 catenin function as a set point for cadherin expression levels in microvascular endothelial cells.
14610055 2003 A core function for p120-catenin in cadherin turnover.
12885254 2003 Adhesion-associated and PKC-modulated changes in serine/threonine phosphorylation of p120-catenin.
12835311 2003 Dual regulation of neuronal morphogenesis by a delta-catenin-cortactin complex and Rho.
12740216 2003 Protein kinase C modifications of VE-cadherin, p120, and beta-catenin contribute to endothelial barrier dysregulation induced by thrombin.
12734196 2003 Characterization of cadherin-24, a novel alternatively spliced type II cadherin.
12671892 2003 Up-regulation, nuclear import, and tumor growth stimulation of the adhesion protein p120 in pancreatic cancer.
12640114 2003 p120 Catenin-associated Fer and Fyn tyrosine kinases regulate beta-catenin Tyr-142 phosphorylation and beta-catenin-alpha-catenin Interaction.
12492499 2002 Altered expression of the catenin p120 in human cancer: implications for tumor progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475979 2003 Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1.
12427869 2002 A novel role for p120 catenin in E-cadherin function.
12370829 2002 The transmembrane receptor protein tyrosine phosphatase DEP1 interacts with p120(ctn).
12151522 2002 Recruitment of the kainate receptor subunit glutamate receptor 6 by cadherin/catenin complexes.
11969288 2002 Dendrite-like process formation and cytoskeletal remodeling regulated by delta-catenin expression.
11896187 2002 Specific sequences in p120ctn determine subcellular distribution of its multiple isoforms involved in cellular adhesion of normal and malignant epithelial cells.
11855855 2002 An octapeptide in the juxtamembrane domain of VE-cadherin is important for p120ctn binding and cell proliferation.
11821434 2002 The Erbin PDZ domain binds with high affinity and specificity to the carboxyl termini of delta-catenin and ARVCF.
11389551 2001 alpha-, beta-, gamma-catenin, and p120(CTN) expression during the terminal differentiation and fusion of human mononucleate cytotrophoblasts in vitro and in vivo.
11382764 2001 Identification of Src phosphorylation sites in the catenin p120ctn.
11181067 2001 The Human DF3/MUC1 carcinoma-associated antigen signals nuclear localization of the catenin p120(ctn).
10931041 2000 E-cadherin-catenin cell-cell adhesion complex and human cancer.
10835420 2000 The protein-tyrosine phosphatase SHP-1 binds to and dephosphorylates p120 catenin.
10753936 2000 Receptor protein-tyrosine phosphatase RPTPmu binds to and dephosphorylates the catenin p120(ctn).
10629228 2000 Selective uncoupling of p120(ctn) from E-cadherin disrupts strong adhesion.
10409703 1999 p120(ctn) binds to the membrane-proximal region of the E-cadherin cytoplasmic domain and is involved in modulation of adhesion activity.
10393933 1999 Nuclear localization of the p120(ctn) Armadillo-like catenin is counteracted by a nuclear export signal and by E-cadherin expression.
10321838 1999 Human p120ctn catenin: tissue-specific expression of isoforms and molecular interactions with BP180/type XVII collagen.
10225956 1999 p120(ctn) acts as an inhibitory regulator of cadherin function in colon carcinoma cells.
10207085 1999 The catenin p120(ctn) interacts with Kaiso, a novel BTB/POZ domain zinc finger transcription factor.
9774455 1998 Modification of the E-cadherin-catenin complex in mitotic Madin-Darby canine kidney epithelial cells.
9653641 1998 Molecular cloning of the human p120ctn catenin gene (CTNND1): expression of multiple alternatively spliced isoforms.
9378757 1997 Cell confluence regulates tyrosine phosphorylation of adherens junction components in endothelial cells.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8808291 1996 The gene encoding p120cas, a novel catenin, localizes on human chromosome 11q11 (CTNND) and mouse chromosome 2 (Catns).
8660921 1996 The novel catenin p120cas binds classical cadherins and induces an unusual morphological phenotype in NIH3T3 fibroblasts.
7876318 1995 Association of p120, a tyrosine kinase substrate, with E-cadherin/catenin complexes.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
7651399 1995 The tyrosine kinase substrate p120cas binds directly to E-cadherin but not to the adenomatous polyposis coli protein or alpha-catenin.
7623846 1995 The cytoplasmic tyrosine kinase FER is associated with the catenin-like substrate pp120 and is activated by growth factors.