Property Summary

NCBI Gene PubMed Count 92
PubMed Score 6.70
PubTator Score 98.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.900 7.9e-04
lung adenocarcinoma -1.300 5.8e-08
non primary Sjogren syndrome sicca 1.100 3.2e-02
osteosarcoma 1.013 2.6e-05
psoriasis -1.100 1.1e-06
subependymal giant cell astrocytoma -1.304 1.2e-02

Protein-protein Interaction (7)

Gene RIF (78)

AA Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA      1 - 70
FSRSETEDRRQ                                                                71 - 81
//

Text Mined References (94)

PMID Year Title