Property Summary

NCBI Gene PubMed Count 89
PubMed Score 6.40
PubTator Score 98.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 1.1e-06
cutaneous lupus erythematosus -1.900 7.9e-04
osteosarcoma 1.013 2.6e-05
non primary Sjogren syndrome sicca 1.100 3.2e-02
subependymal giant cell astrocytoma -1.304 1.2e-02
lung adenocarcinoma -1.300 5.8e-08

Synonym

Accession Q9NSA3 Q5T4V2
Symbols ICAT

Gene

PDB

1T08   1LUJ   1M1E  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (75)

PMID Text
26317904 Data show that microRNA miR-215 activates beta-catenin pathways by decreasing catenin beta interacting protein 1 (CTNNBIP1)expression in gliomas.
26299367 CTNNBIP1 expression correlated with longer overall survival in LAC patients. This study reveals that miR-214 plays a critical role in CSLC self-renewal and stemness by targeting CTNNBIP1.
26284974 Finally, pro-incubation with idebenone inhibited mitochondrial dysfunction induced by oxLDL through the mitochondrial-dependent apoptotic pathway and GSK3beta/beta-catenin signalling pathways.
26124339 Nuclear YAP and cytoplasmic beta-catenin play important roles in carcinogenesis.
26124325 A statistically significant lapatinib- and gefitinib-induced repression of cyclin D1, MMP9 and beta-catenin in CERV196 cells.
26047787 Particulate matter (PM10) downregulates E-Cadherin/beta-Catenin expression.
25849888 These results indicate that beta-catenin translation is initiated via the IRES and this is regulated by PTX, suggesting that regulation of the IRES-dependent translation of beta-catenin may be involved in the cancer cell response to PTX treatment.
25845340 Simultaneous silencing of beta-catenin and STAT3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells.
25681036 miR-603 regulates glioma development via Wnt-beta-cateninn signaling pathway and its WIF1 and CTNNBIP1 targets.
25445594 Our results indicate that HDAC1 plays an important role in chondrogenesis and may represent a therapeutic target for modulation of cartilage development.
25434796 ICAT may serve as a tumor-suppressor in human glioma.
25404731 Suppressing TrpC5 expression decreased nuclear beta-catenin accumulation, reduced the induction of ABCB1, and reversed 5-fluorouracil neoplastic resistance.
25344754 ASPP2 prevents beta-catenin from transactivating ZEB1 directly by forming an ASPP2-beta-catenin-E-cadherin ternary complex
25193262 review of control of cell fate and proliferation in colon cancer
25175916 A potent beta-catenin inhibitor, ICAT/CTNNBIP1 was a direct target of miR-424-5p.
24514042 beta-catenin inhibitor ICAT modulates the invasive motility of melanoma cells.
24390805 It involved in the control of cell growth, differentiation, and apoptosis.
23973669 The data show that Snail1 and beta-catenin, besides association with loss of hormone dependence, protect cancer cells from hypoxia and may serve as an important target in the treatment of breast cancer.
23971040 Thus, our results indicated abnormal expression of CD44V6, CDH11, and beta-catenin in osteosarcomas and osteochondromas, which may provide important indicators for further research.
23928935 Neither cyclin D1 nor beta-catenin was expressed in a statistically significant manner, concluding that the development of MCCs is independent of beta-catenin and cyclin D1 expression and these proteins are not suitable as prognostic markers.
23752183 PTHrP was found to inhibit DKK1 expression through c-Jun-mediated inhibition of beta-catenin activity on the DKK1 promoter.
23648139 beta-catenin accumulation in the nucleus regulates expression of Nanog protein and has a role in progression of non-small cell lung cancer
23612487 These findings suggest that Sphingosine-1-phosphate activates signaling leading to nuclear translocation of beta-catenin in osteoblast-like cells and upregulation of osteoptotegerin and osteoblast differentiation markers
23572266 beta-catenin is delocalized and survivin is over-expressed in recurrent sporadic and nevoid basal cell carcinoma syndrome-associated keratocystic odontogenic tumor
23339455 ICAT is a novel Ptf1a interactor that regulates pancreatic acinar differentiation and displays altered expression.
23110823 This study demonistrated that mean protein and mRNA levels of beta-catenin were significantly decreased in both the PFC and hippocampus of teenage suicide group compared to controls.
23027379 In this review, we will discuss the points of intersection between the Wnt/beta-catenin and Hippo/YAP pathways and how these interactions contribute to homeostasis, organ repair, and tumorigenesis.
22815884 R-Spondin potentiates Wnt/beta-catenin signaling through orphan receptors LGR4 and LGR5
22749188 our data clearly identify protein stabilizing mutations of the beta-catenin gene as a common feature of nested stromal epithelial tumors of the liver, similarly as in hepatoblastomas.
22525043 beta-catenin was significantly associated with nodal stage, TNM stage, and E-cadherin expression. beta-catenin could be early marker for identification of occult metastases in oral SCC.
22081448 Airway basal cell beta-catenin determines cell fate and its mis-expression is associated with the development of human lung cancer.
22075503 Cholangiocarcinoma cell lines express E-cad and beta-cat but with different localizat- ion patterns.
21885566 Inhibitor of beta-catenin and T-cell factor (ICAT), a beta-catenin binding protein that inhibits the canonical Wnt/beta-catenin signaling pathway, in AR signaling, was investigated.
21791486 Microatellite-stable cases exhibited reduced membranous beta catenin and increased cytoplasmic and nuclear beta catenin compared with microsatellite-instable cases.
21636708 High beta-catenin is associated with glioma progression.
21574102 When both E-cadherin and beta -catenin expressions were reduced, there was a significant unfavourable prognosis.
21532622 ICAT is a direct transcriptional target of E2F1, and activation of ICAT by E2F1 is required for E2F1 to inhibit beta-catenin activity.
21478268 A coactivator role of CARM1 in the dysregulation of beta-catenin activity in colorectal cancer cell growth and gene expression
21336584 LMP1 may be involved in nasopharyngeal carcinogenesis via beta-catenin signaling pathway
21049553 Data show that elevated beta-catenin expression level may be an adverse indicator for the prognosis of ESCC patients at stage T2-3N0M0, especially for those with T3 lesions or stage IIB diseases.
20970365 beta-catenin is expressed in actinic chelitis and squamous cell carcinoma of the lip
20878057 cytoplasmic accumulation of beta-catenin can induce Tcf/Lef-mediated transcriptional activity, up-regulate MMP-7, and induce epithelial and mesenchymal transition (EMT).
20830236 our results support the concept that STAT3 upregulates the protein expression and transcriptional activity of beta-catenin in breast cancer.
20811694 The results from the current study demonstrated the importance of the Wnt/beta-catenin signaling pathway in regulation of gene expression in hepatocellular carcinoma
20809334 The protein expression levels of Wnt1, beta-catenin and Cyclin D1 were all positively correlated with the Karnofsky performance scale (KPS) score and World Health Organization (WHO) grades of patients with gliomas.
20300972 overexpression of beta-catenin may be an important contributing factor to glioma progression.
20219600 The results showed no differences in the expression of beta-catenin between tooth germs and solid and unicystic ameloblastomas.
20182836 Our results suggest that beta-catenin is useful for the prognosis evaluation of astrocytoma.
20034989 Reduced/aberrant beta-catenin expression was seen in benign and malignant salivary gland tumors.
19898961 beta-catenin-a marker of early stage of colorectal carcinogenesis, as well as TGF-beta1 and HIF-1alpha appear to be devoid of prognostic significance for colorectal cancer in this study of disease free survival
19569129 Over-expression of ICAT was not sufficient to induce monocytic differentiation of HL60 cells; overexpression of ICAT enhanced differentiation of HL60 cells stimulated by all-trans retinoic acid or NSC67657.
19550115 ICAT expression was upregulated during NSC67657-induced differentiation of HL-60 cells.
19089909 decreased expression of the Hint1 gene through epigenetic silencing may play a role in enhancing the growth of a subset of human hepatoma by increasing the expression of genes controlled by the transcription factors beta-catenin, USF2, and NFkappaB
19038973 The results suggest that WNT2 could act through its receptor FZD9 to regulate the beta-CATENIN pathway in cumulus cells, recruiting beta-CATENIN into plasma membranes and promoting the formation of adherens junctions involving CDH1.
18992165 Increased expression in colorectal adenomas, high-grade intraepithelial neoplasia and adenocarcinomas than in the adjacent normal epithelia
18854359 The CID domain of APC is required to down-regulate the transcriptional activity and the level of beta-catenin.
18852287 Results indicate that association of c-Jun, TCF$, and beta-catenin with a downstream enhancer element provides the principal regulation of c-Myc expression.
18844223 adenomatous polyposis coli gene and nuclear b-catenin may have roles in wnt-related progression of invasive urothelial carcinomas
18806748 The presence of beta-catenin expression was detected in gastric tumors of the patients without distant metastases
18715618 The matrix metalloproteinase-7 gene may be up-regulated by mutated or continuously elevated beta-catenin protein in sporadic desmoid tumors.
18705344 In the gastric cancerous tissues, the expression percentage of Wnt-1, beta-catenin and E-cadherin is 54.4%, 45.6%, 47.2%, respectively, which is significantly higher than the percentage expression of these genes in normal tissues (p<0.01).
18500270 There was a direct relationship between tamoxifen exposure and overexpression of beta-catenin oncoprotein in endometrial adenocarcinoma.
18433021 Beta-catenin and HNF1alpha could regulate miR-375 and miR-107 expression levels, respectively, in hepatocellular tumors.
18183411 Beta-catenin expression is not reduced in laryngeal squamous expithelium of patients with laryngopharyngeal reflux.
18070361 Amyloid protein precursor induced phosphorylation of beta catenin, resulted in the reduction of total beta-catenin levels.
17638851 Strategies targeting signals in the marrow microenvironment that amplify the Bcr-abl/VE-cadherin/beta-catenin axis may have utility in sensitizing drug-resistant leukemic stem cells.
17418091 The retained beta-catenin in cytoplasm by APC may be down-regulated by Axin 2, which is induced by beta-catenin/Tcf signaling.
17255093 in motile cells beta-catenin is recruited by IQGAP1 and N-cadherin to active membrane ruffles, wherein beta-catenin mediates the internalization and possible recycling of the membrane-associated proteins N-cadherin and APC
16575872 The comparison between Wilms tumors with and without CTNNB1 mutations revealed several target genes specifically deregulated in CTNNB1-mutated Wilms tumors
15063782 We also found that cyclin A/CDK2 phosphorylates Axin, thereby enhancing its association with beta-catenin.
14613891 ICAT's primary role in beta-catenin signaling inhibition and further suggest that ICAT may have consequences for cadherin-based adhesive function in certain circumstances
12408825 Data report the elucidation of the crystal structure of ICAT, an inhibitor of beta-catenin-mediated transcription, bound to the armadillo repeat domain of beta-catenin.
12182422 presentation of medulloblastoma in two siblings (one of each sex) and their great-uncle; immunostaining for gene products in medulloblastoma differed in the two siblings for beta-catenin and was similar with staining for gli.
12124804 Molecular genetic analysis of malignant melanomas for aberrations of the WNT signaling pathway genes CTNNB1, APC, ICAT and BTRC.
12068170 stimulation of beta-catenin and suppression of gamma-catenin expression, occur within endometrial carcinomas with squamous differentiation

AA Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA      1 - 70
FSRSETEDRRQ                                                                71 - 81
//

Text Mined References (91)

PMID Year Title
26317904 2015 MiR-215, an activator of the CTNNBIP1/?-catenin pathway, is a marker of poor prognosis in human glioma.
26299367 2015 Targeting the Wnt-Regulatory Protein CTNNBIP1 by microRNA-214 Enhances the Stemness and Self-Renewal of Cancer Stem-Like Cells in Lung Adenocarcinomas.
26284974 2015 Idebenone protects against oxidized low density lipoprotein induced mitochondrial dysfunction in vascular endothelial cells via GSK3?/?-catenin signalling pathways.
26124339 2015 Altered Expression of Yes-associated Protein and ?-Catenin in Non-neoplastic and Neoplastic Gastric Surface Epithelia.
26124325 2015 MMP9, Cyclin D1 and ?-Catenin Are Useful Markers of p16-positive Squamous Cell Carcinoma in Therapeutic EGFR Inhibition In Vitro.
26047787 2015 Particulate matter (PM??) induces metalloprotease activity and invasion in airway epithelial cells.
25849888 2015 ?-Catenin expression is regulated by an IRES-dependent mechanism and stimulated by paclitaxel in human ovarian cancer cells.
25845340 2015 Simultaneous silencing of ?-catenin and signal transducer and activator of transcription 3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells.
25681036 2015 miR-603 promotes glioma cell growth via Wnt/?-catenin pathway by inhibiting WIF1 and CTNNBIP1.
25445594 2014 Histone deacetylase1 promotes TGF-?1-mediated early chondrogenesis through down-regulating canonical Wnt signaling.
25434796 2015 ICAT inhibits glioblastoma cell proliferation by suppressing Wnt/?-catenin activity.
25416956 2014 A proteome-scale map of the human interactome network.
25404731 2015 Inhibition of transient receptor potential channel 5 reverses 5-Fluorouracil resistance in human colorectal cancer cells.
25344754 2014 ASPP2 controls epithelial plasticity and inhibits metastasis through ?-catenin-dependent regulation of ZEB1.
25193262 2014 New perspectives on ?-catenin control of cell fate and proliferation in colon cancer.
25175916 2014 MiR-424-5p reversed epithelial-mesenchymal transition of anchorage-independent HCC cells by directly targeting ICAT and suppressed HCC progression.
24514042 2014 ?-catenin inhibitor ICAT modulates the invasive motility of melanoma cells.
24390805 2014 Effects of genistein and daidzein on cell proliferation kinetics in HT29 colon cancer cells: the expression of CTNNBIP1 (?-catenin), APC (adenomatous polyposis coli) and BIRC5 (survivin).
23973669 2013 Snail/beta-catenin signaling protects breast cancer cells from hypoxia attack.
23971040 2013 The prognostic significance of CD44V6, CDH11, and ?-catenin expression in patients with osteosarcoma.
23928935 2013 Expression of ?-catenin and cyclin D1 in Merkel cell carcinomas of the head and neck.
23752183 2014 Parathyroid hormone-related protein inhibits DKK1 expression through c-Jun-mediated inhibition of ?-catenin activation of the DKK1 promoter in prostate cancer.
23648139 2013 Nuclear ?-catenin accumulation is associated with increased expression of Nanog protein and predicts poor prognosis of non-small cell lung cancer.
23612487 2013 Sphingosine-1-phosphate promotes the nuclear translocation of ?-catenin and thereby induces osteoprotegerin gene expression in osteoblast-like cell lines.
23572266 2013 Beta-catenin and survivin expression in keratocystic odontogenic tumor (KCOT). A comparative immunohistochemical study in primary, recurrent and nevoid basal cell carcinoma syndrome (NBCCS)-associated lesions.
23339455 2013 ICAT is a novel Ptf1a interactor that regulates pancreatic acinar differentiation and displays altered expression in tumours.
23110823 2013 Altered Wnt signalling in the teenage suicide brain: focus on glycogen synthase kinase-3? and ?-catenin.
23027379 2013 Intersection of Hippo/YAP and Wnt/?-catenin signaling pathways.
22815884 2012 R-Spondin potentiates Wnt/?-catenin signaling through orphan receptors LGR4 and LGR5.
22749188 2012 ?-Catenin mutations in 2 nested stromal epithelial tumors of the liver--a neoplasia with defective mesenchymal-epithelial transition.
22525043 2013 E-cadherin and ?-catenin expression in well-differentiated and moderately-differentiated oral squamous cell carcinoma: relations with clinical variables.
22081448 2012 ?-Catenin determines upper airway progenitor cell fate and preinvasive squamous lung cancer progression by modulating epithelial-mesenchymal transition.
22075503 2011 Expression of E-cadherin and ?-catenin in two cholangiocarcinoma cell lines (OZ and HuCCT1) with different degree of invasiveness of the primary tumor.
21885566 2011 The beta-catenin binding protein ICAT modulates androgen receptor activity.
21791486 2011 Epithelial-mesenchymal transition (EMT) protein expression in a cohort of stage II colorectal cancer patients with characterized tumor budding and mismatch repair protein status.
21636708 2011 High ?-catenin/Tcf-4 activity confers glioma progression via direct regulation of AKT2 gene expression.
21574102 2011 Immunohistochemical study of E-cadherin and ?-catenin expression in colorectal carcinomas.
21532622 2011 E2F1 suppresses Wnt/?-catenin activity through transactivation of ?-catenin interacting protein ICAT.
21478268 2011 A coactivator role of CARM1 in the dysregulation of ?-catenin activity in colorectal cancer cell growth and gene expression.
21336584 2011 EBV-encoded LMP1 increases nuclear ?-catenin accumulation and its transcriptional activity in nasopharyngeal carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21049553 2010 Prognostic relevance of ?-catenin expression in T2-3N0M0 esophageal squamous cell carcinoma.
20970365 2011 Altered ?-catenin expression related to cancer progression on actinic cheilitis and squamous cell carcinoma of the lip.
20878057 2010 Involvement of the Wnt-?-catenin pathway in invasion and migration of oral squamous carcinoma cells.
20830236 2010 STAT3 upregulates the protein expression and transcriptional activity of ?-catenin in breast cancer.
20811694 2010 beta-catenin siRNA regulation of apoptosis- and angiogenesis-related gene expression in hepatocellular carcinoma cells: potential uses for gene therapy.
20809334 2011 Wnt/beta-Catenin pathway in human glioma: expression pattern and clinical/prognostic correlations.
20300972 2011 ?-Catenin overexpression in malignant glioma and its role in proliferation and apoptosis in glioblastma cells.
20219600 2010 Immunohistochemical expression of E-cadherin and beta-catenin in ameloblastomas and tooth germs.
20182836 2010 Reduced beta-catenin expression is associated with good prognosis in Astrocytoma.
20034989 2011 ?-Catenin expression in benign and malignant salivary gland tumors.
19898961 2010 Comparison of beta-catenin with TGF-beta1, HIF-1alpha and patients' disease-free survival in human colorectal cancer.
19569129 2009 ICAT as a potential enhancer of monocytic differentiation: implications from the comparative proteome analysis of the HL60 cell line stimulated by all-trans retinoic acid and NSC67657.
19550115 2009 Comparative proteomics analysis on differentiation of human promyelocytic leukemia HL-60 cells into granulocyte and monocyte lineages.
19089909 2009 HINT1 inhibits beta-catenin/TCF4, USF2 and NFkappaB activity in human hepatoma cells.
19038973 2009 Identification of WNT/beta-CATENIN signaling pathway components in human cumulus cells.
18992165 2008 Clinicopathological significance of expression of p-c-Jun, TCF4 and beta-Catenin in colorectal tumors.
18977368 2008 ICAT participates in proliferation and osteogenic differentiation of human adipose tissue-derived mesenchymal stem cell.
18854359 2009 Beta-catenin degradation mediated by the CID domain of APC provides a model for the selection of APC mutations in colorectal, desmoid and duodenal tumours.
18852287 2008 A genome-wide screen for beta-catenin binding sites identifies a downstream enhancer element that controls c-Myc gene expression.
18844223 2009 Somatic mutations of adenomatous polyposis coli gene and nuclear b-catenin accumulation have prognostic significance in invasive urothelial carcinomas: evidence for Wnt pathway implication.
18806748 2008 Relation between cell-to-cell adhesion and angiogenesis and clinico-morphological prognostic factors in patients with gastric cancer.
18715618 2008 Correlation between beta-catenin widespread nuclear expression and matrix metalloproteinase-7 overexpression in sporadic desmoid tumors.
18705344 Wnt pathway is involved in advanced gastric carcinoma.
18500270 2008 Clinicopathological and molecular analysis of endometrial carcinoma associated with tamoxifen.
18433021 2008 MicroRNA profiling in hepatocellular tumors is associated with clinical features and oncogene/tumor suppressor gene mutations.
18287330 2008 VE-cadherin and beta-catenin binding dynamics during histamine-induced endothelial hyperpermeability.
18183411 2008 E-cadherin but not beta-catenin expression is decreased in laryngeal biopsies from patients with laryngopharyngeal reflux.
18070361 2007 Amyloid precursor protein modulates beta-catenin degradation.
17638851 2007 Ph+/VE-cadherin+ identifies a stem cell like population of acute lymphoblastic leukemia sustained by bone marrow niche cells.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17418091 2007 Axin-independent phosphorylation of APC controls beta-catenin signaling via cytoplasmic retention of beta-catenin.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17255093 2007 IQ-domain GTPase-activating protein 1 regulates beta-catenin at membrane ruffles and its role in macropinocytosis of N-cadherin and adenomatous polyposis coli.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16575872 2006 Target genes of the WNT/beta-catenin pathway in Wilms tumors.
16293619 2006 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16188939 2005 The adenomatous polyposis coli protein (APC) exists in two distinct soluble complexes with different functions.
15893313 2005 The inhibitory mechanism of curcumin and its derivative against beta-catenin/Tcf signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15063782 2004 Cyclin-dependent kinase 2 regulates the interaction of Axin with beta-catenin.
14613891 2004 Role for ICAT in beta-catenin-dependent nuclear signaling and cadherin functions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417602 2002 Mutation and expression of the beta-catenin-interacting protein ICAT in human colorectal tumors.
12408825 2002 ICAT inhibits beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules.
12408824 2002 The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT.
12182422 2002 Familial medulloblastoma: case report of one family and review of the literature.
12124804 2002 Molecular genetic analysis of malignant melanomas for aberrations of the WNT signaling pathway genes CTNNB1, APC, ICAT and BTRC.
12068170 2002 Loss of gamma-Catenin expression in squamous differentiation in endometrial carcinomas.
10898789 2000 Inhibition of Wnt signaling by ICAT, a novel beta-catenin-interacting protein.