Property Summary

Ligand Count 5
NCBI Gene PubMed Count 1,998
PubMed Score 9786.05
PubTator Score 5488.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Obesity 678
Abdominal Pain 98
Abnormal hypothalamus morphology 3
Abnormality of metabolism/homeostasis 134
Abnormality of retinal pigmentation 111
Abnormality of the abdominal wall 10
Abnormality of the musculature 16
Bitemporal Hemianopia 2
Central Diabetes Insipidus 5
Cerebral calcification 43
Cognitive delay 608
Colorectal cancer 25
Decreased visual acuity, slowly progressive 13
Dull intelligence 645
Dysgerminoma 11
Fibromatosis, Aggressive 3
Gastrointestinal polyps 5
Global developmental delay 608
Headache 37
Hereditary nonpolyposis colorectal carcinoma 18
Hyperprolactinemia 27
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypoplasia of corpus callosum 90
Increased gastric cancer 21
Increased hepatocellular carcinoma risk 27
Increased incidence of hepatocellular carcinoma 27
Infantile onset 238
Intellectual disability 1016
Intestinal Polyposis 6
Intracranial cystic lesion 2
Leiomyosarcoma of uterus 13
Little's Disease 14
Liver carcinoma 240
Long philtrum 137
Low intelligence 645
Malabsorption 82
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse 12
Malignant neoplasm of ovary 4
Mammary Neoplasms 425
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Micronodular cirrhosis 12
Multiple, subcutaneous nodules 53
Muscle hypotonia 571
Myalgia 54
Nausea and vomiting 97
Neoplasm of the anterior pituitary 2
Ovarian papillary adenocarcinoma 5
Pancreatic Neoplasm 85
Papilledema 11
Pituitary gland enlarged 2
Poor school performance 645
Progressive visual field defects 3
Renal Cell Carcinoma 214
Retinal pigment epithelial abnormality 111
Schizophrenia 1160
Secondary Adrenal Insufficiency 6
Secondary hypothyroidism 15
Slow decrease in visual acuity 13
Small head 374
Somatic mutation 61
Somnolence 15
Speech Disorders 58
Stomach Neoplasms 300
Strabismus 270
Subacute progressive viral hepatitis 9
Subcutaneous nodule 53
Thin upper lip vermilion 67
Transitional cell carcinoma of bladder 17
Uterine Cervical Neoplasm 25
Visual field tests abnormal 2
breast carcinoma 1638
malignant mesothelioma 3232
ovarian neoplasm 99
Disease Target Count Z-score Confidence
Osteoporosis 363 4.713 2.4

Expression

See source...

Protein-protein Interaction (4)

PDB (18)

Gene RIF (1719)

AA Sequence

MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGF      1 - 70
SQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLI     71 - 140
NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET    141 - 210
ARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQ    211 - 280
KMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC    281 - 350
SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA    351 - 420
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG    421 - 490
LPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF    491 - 560
VEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEA    561 - 630
IEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI    631 - 700
GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGD    701 - 770
SNQLAWFDTDL                                                               771 - 781
//

Text Mined References (2024)

PMID Year Title