Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.34
PubTator Score 11.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 4.2e-04
chronic rhinosinusitis -1.046 1.2e-02
ductal carcinoma in situ -1.100 3.5e-03
ependymoma 1.200 1.0e-08
glioblastoma 1.100 2.1e-02
group 3 medulloblastoma 1.200 7.3e-03
invasive ductal carcinoma -1.140 7.9e-03
lung adenocarcinoma -1.400 1.1e-11
non-small cell lung cancer -1.309 2.9e-15
ovarian cancer -2.800 1.4e-11
pancreatic cancer 1.100 2.3e-04
pancreatic carcinoma 1.100 2.3e-04
pituitary cancer 1.100 3.4e-05
tuberculosis -1.600 8.3e-06

Gene RIF (17)

AA Sequence

MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKKSDKTLQAIQR      1 - 70
VGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDITNLNHLESDGQITIFTDKTG     71 - 140
VIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMERLEKVNSFQEFVQIFSQFGNEMVEFAHLSGD    141 - 210
RQNDLKDEKKKAKMAAARAVLEKCTMMLLTASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCK    211 - 280
PNGETDISSISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELS    281 - 350
TQARMELQQLISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKA    351 - 420
LKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTL    421 - 490
HPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYGYLSLPKPMKNNANLKSLKPDKPDSE    491 - 560
EQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNMSSMAYSLYLFTRGEGPLKTSQDLIHQLEVF    561 - 630
AAEGLKLTSSVQAFSKQLKDDDKLMLLLEINKLIPLCHQLQTVTKTSLQNKVFLKVDKCITKTRSMMALL    631 - 700
VQLLSLCYKLLKKLQMENNGWVSVTNKDTMDSKT                                        701 - 734
//

Text Mined References (30)

PMID Year Title