Property Summary

NCBI Gene PubMed Count 50
PubMed Score 36.00
PubTator Score 34.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.100 3.3e-04
oligodendroglioma -1.700 4.5e-02
ependymoma -1.700 2.5e-05
glioblastoma 1.200 2.2e-03
group 3 medulloblastoma -2.600 1.6e-02
atypical teratoid/rhabdoid tumor -1.800 8.6e-04
medulloblastoma, large-cell 1.500 1.0e-04
Becker muscular dystrophy -1.038 1.2e-02
type 2 diabetes -1.002 6.7e-03
colon cancer -1.500 6.8e-03
subependymal giant cell astrocytoma -2.102 4.3e-02
ovarian cancer -1.300 3.3e-09

Gene RIF (44)

PMID Text
26507551 Two African-ancestry specific variants were found to be significantly associated with metabolic syndrome S: SNP rs73989312[A] near CA10 that conferred increased risk; and SNP rs77244975[C] in CTNNA3 that conferred protection against this disease.
26188062 Copy Number Variations in CTNNA3 and RBFOX1 Associate with Pediatric Food Allergy
26073756 CTNNA3 and SEMA3D: Promising loci for asthma exacerbation identified through multiple genome-wide association studies
25345593 This study demonstrated that the copy number variations of CTNNA3 relate to opioid dependence.
24407380 CTNNA3 is not major contributor or genetic risk factor for childhood asthma but rather influence the disease expression and response to therapy.
24358122 These results suggest aberrant Claudin 7, alpha - and beta-catenin expression and/or localisation patterns may be putative markers for distinguishing localised prostate cancer from aggressive metastatic disease when used collectively.
24100690 CTNNA2 and CTNNA3 are tumor suppressor genes frequently mutated in laryngeal carcinomas.
23358160 Significant interaction with maternal CMV infection was found for rs7902091 (PSNP x CMV=7.3 x 10-7) in CTNNA3, a gene not previously implicated in schizophrenia.
23136403 Results suggest a causal relationship between CTNNA3 mutations and arrhythmogenic right ventricular cardiomyopathy
23077317 HIV-1 gp41 and alpha-catenin co-localize in gp160 and GST-alpha-catenin expressing cells; the leucine zipper-like domain (gp160 residues 791-824) of gp41 interacts strongly with the carboxy terminus (residues 795-906) of alpha-catenin
22977168 GWAS study of diisocyanate asthma demonstrates an association between two closely linked CTNNA3 gene SNPs and diisocyanate asthma.
22948383 Five genes have been directly disrupted in Tourette Syndrome by independent genomic rearrangements and copy number variations with unique breakpoints.
22398721 A VE-cadherin-PAR3-alpha-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)alpha in endothelial cells.
22190034 HIV-1 gp41 and alpha-catenin co-localize in gp160 and GST-alpha-catenin expressing cells; the leucine zipper-like domain (gp160 residues 791-824) of gp41 interacts strongly with the carboxy terminus (residues 795-906) of alpha-catenin
21598020 Apart from the complexity of its regulation, alterations in both CTNNA3 and LRTMM3 are implicated in human disease.
21562850 Low alpha catenin is involved in colorectal cancer metastasis.
21254927 Our comprehensive mutation scanning did not identify any Arrhythmogenic right ventricular cardiomyopathy (ARVC) causing mutations.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546594 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20400461 The risk allele (Y153H) of the preeclampsia susceptibility gene STOX1 negatively regulates trophoblast invasion by upregulation of the cell-cell adhesion protein a-T-catenin (CTNNA3).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19187332 Results suggest that multiple genetic polymorphisms of CTNNA3 may be determinants of susceptibility to toluene diisocyanate-induced induced asthma.
19187332 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19105203 Observational study of gene-disease association. (HuGE Navigator)
18163421 Significant association with late-onset Alzheimer's disease for 4 SNPs: rs1881747 near DKK1, rs2279420 in ANK3, rs2306402 in CTNNA3, and rs5030882 in CXXC6 in 1,160 cases and 1,389 controls.
18163421 Observational study of gene-disease association. (HuGE Navigator)
17761686 Observational study of gene-disease association. (HuGE Navigator)
17761686 CTNNA3 may affect late-onset Alzheimer's disease through a female-specific mechanism independent of the APOE-epsilon4 allele.
17535849 By providing an extra link between the cadherin-catenin complex and intermediate filaments, the binding of alphaT-catenin to plakophilin-2 is proposed to be a means of modulating and strengthening cell-cell adhesion between cardiac muscle cells.
17366617 In conclusion, monoallelic and biallelic CTNNA3 expression patterns are demonstrable in tumor bladder tissue, whereas normal cases show only biallelic expression.
17209133 Observational study of gene-disease association. (HuGE Navigator)
17209133 This is the first study to report evidence of an association between a potentially functional, non-synonymous SNP in VR22 and the risk for Alzheimer's disease.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16199552 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16199552 VR22 or a nearby gene influences susceptibility to Alzheimer's disease, and the effect is dependent on APOE status
15533819 Dosage compensation of CTNNA3 and p57KIP2 in the placenta shares a conserved regulatory mechanism.
15302915 GATA-4 and MEF2C transcription factors transactivate the alphaT-catenin gene CTNNA3 in a tissue-specific manner.
15075440 We found no association between CTNNA3 and Alzheimer disease in subjects showing linkage to chromosome 10, nor were these SNPs associated with Abeta deposition in brain. CTNNA3 is unlikely to account for the susceptibility locus on chromosome 10
14559775 Alpha-T catenin gene has variants which influence Abeta42 and contribute to the previously reported linkage for plasma Abeta42 in late-onset Alzheimer's disease families.
12596047 gene localized on chromosome 10q21 and is 1,776 kb in length; mutation screening of all 18 exons of the CTNNA3 gene in a family showing dilated cardiomyopathy (DCM)linkage to the 10q21-q23 locus, however, has not detected any DCM-linked CTNNA3 mutations
11883950 HIV-1 gp41 and alpha-catenin co-localize in gp160 and GST-alpha-catenin expressing cells; the leucine zipper-like domain (gp160 residues 791-824) of gp41 interacts strongly with the carboxy terminus (residues 795-906) of alpha-catenin
10420987 HIV-1 gp41 and alpha-catenin co-localize in gp160 and GST-alpha-catenin expressing cells; the leucine zipper-like domain (gp160 residues 791-824) of gp41 interacts strongly with the carboxy terminus (residues 795-906) of alpha-catenin

AA Sequence

MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLL      1 - 70
DKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILAD     71 - 140
MIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARAS    141 - 210
LKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDEL    211 - 280
ENLIVLNPLTVTEEEIRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNA    281 - 350
GKKERSNTLNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE    351 - 420
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTMEMYKRTWENHI    421 - 490
HVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEP    491 - 560
GAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTP    561 - 630
EELEDVSDLEEEHEVRSHTSIQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSND    631 - 700
IIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLE    701 - 770
QIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG    771 - 840
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY                   841 - 895
//

Text Mined References (52)

PMID Year Title
26507551 2015 Genome-wide association study identifies African-ancestry specific variants for metabolic syndrome.
26188062 2015 Copy Number Variations in CTNNA3 and RBFOX1 Associate with Pediatric Food Allergy.
26073756 2015 CTNNA3 and SEMA3D: Promising loci for asthma exacerbation identified through multiple genome-wide association studies.
25345593 2015 Genome-wide association study of copy number variations (CNVs) with opioid dependence.
24407380 2014 Polymorphisms in recent GWA identified asthma genes CA10, SGK493, and CTNNA3 are associated with disease severity and treatment response in childhood asthma.
24358122 2013 The role of adhesion molecules as biomarkers for the aggressive prostate cancer phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100690 2013 Cell-cell adhesion genes CTNNA2 and CTNNA3 are tumour suppressors frequently mutated in laryngeal carcinomas.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23358160 2014 Genome-wide study of association and interaction with maternal cytomegalovirus infection suggests new schizophrenia loci.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23136403 2013 Mutations in the area composita protein ?T-catenin are associated with arrhythmogenic right ventricular cardiomyopathy.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22977168 2013 CTNNA3 (?-catenin) gene variants are associated with diisocyanate asthma: a replication study in a Caucasian worker population.
22948383 2012 Pathogenetic model for Tourette syndrome delineates overlap with related neurodevelopmental disorders including Autism.
22398721 2012 A VE-cadherin-PAR3-?-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)? in endothelial cells.
22190034 2011 Global landscape of HIV-human protein complexes.
21598020 2011 Alpha T-catenin (CTNNA3): a gene in the hand is worth two in the nest.
21562850 2012 MicroRNA-9 up-regulation is involved in colorectal cancer metastasis via promoting cell motility.
21254927 2011 Screening of three novel candidate genes in arrhythmogenic right ventricular cardiomyopathy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20546594 2010 An application of Random Forests to a genome-wide association dataset: methodological considerations & new findings.
20400461 2010 The STOX1 genotype associated with pre-eclampsia leads to a reduction of trophoblast invasion by alpha-T-catenin upregulation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19187332 2009 Alpha-T-catenin (CTNNA3) gene was identified as a risk variant for toluene diisocyanate-induced asthma by genome-wide association analysis.
19105203 2009 An association analysis of Alzheimer disease candidate genes detects an ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18163421 2008 Association analysis of 528 intra-genic SNPs in a region of chromosome 10 linked to late onset Alzheimer's disease.
17761686 2007 Genetic association of CTNNA3 with late-onset Alzheimer's disease in females.
17535849 2007 A unique and specific interaction between alphaT-catenin and plakophilin-2 in the area composita, the mixed-type junctional structure of cardiac intercalated discs.
17366617 2007 Alpha-T-catenin (CTNNA3) displays tumour specific monoallelic expression in urothelial carcinoma of the bladder.
17209133 2007 Is alpha-T catenin (VR22) an Alzheimer's disease risk gene?
17158188 2007 Novel genes identified in a high-density genome wide association study for nicotine dependence.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16199552 2005 Interaction between the alpha-T catenin gene (VR22) and APOE in Alzheimer's disease.
15533819 2004 Differential downregulation of alphaT-catenin expression in placenta: trophoblast cell type-dependent imprinting of the CTNNA3 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302915 2004 GATA-4 and MEF2C transcription factors control the tissue-specific expression of the alphaT-catenin gene CTNNA3.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15075440 2004 Alpha-T-catenin is expressed in human brain and interacts with the Wnt signaling pathway but is not responsible for linkage to chromosome 10 in Alzheimer's disease.
14559775 2003 Fine mapping of the alpha-T catenin gene to a quantitative trait locus on chromosome 10 in late-onset Alzheimer's disease pedigrees.
12596047 2003 Assessment of the CTNNA3 gene encoding human alpha T-catenin regarding its involvement in dilated cardiomyopathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590244 2001 alphaT-catenin: a novel tissue-specific beta-catenin-binding protein mediating strong cell-cell adhesion.