Property Summary

NCBI Gene PubMed Count 111
PubMed Score 78.10
PubTator Score 255.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 3.465 1.7
Acquired thrombocytopenia 8 3.365 1.7

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.035 9.6e-05
astrocytic glioma 1.400 1.2e-02
Astrocytoma, Pilocytic 1.700 1.7e-03
atypical teratoid / rhabdoid tumor 3.700 1.5e-07
dermatomyositis 1.100 1.1e-03
ependymoma 2.300 5.6e-03
gastric cancer -1.700 3.9e-02
glioblastoma 1.400 1.1e-02
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.5e-02
invasive ductal carcinoma -1.106 3.9e-02
medulloblastoma 1.700 5.5e-03
medulloblastoma, large-cell 2.000 5.1e-04
Multiple myeloma 1.040 5.3e-03
oligodendroglioma 1.700 6.2e-03
osteosarcoma 1.690 2.2e-03
ovarian cancer -1.200 7.4e-12
pancreatic cancer -1.900 3.0e-02
pancreatic carcinoma -1.900 3.0e-02
pediatric high grade glioma 2.300 6.2e-04
primary pancreatic ductal adenocarcinoma 1.033 1.6e-02
primitive neuroectodermal tumor 1.400 4.5e-04
psoriasis 1.200 1.8e-03
Waldenstrons macroglobulinemia 1.036 1.8e-03

Protein-protein Interaction (7)

Gene RIF (60)

AA Sequence

MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATE      1 - 70
NFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLI     71 - 140
LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAA    141 - 210
RGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAY    211 - 280
ALNNFDKQIIVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSE    281 - 350
YMGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA    351 - 420
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQ    421 - 490
WEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEM    491 - 560
DNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVL    561 - 630
MIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDA    631 - 700
EVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDS    701 - 770
ACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS    771 - 840
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI        841 - 906
//

Text Mined References (134)

PMID Year Title