Property Summary

NCBI Gene PubMed Count 44
PubMed Score 62.32
PubTator Score 37.35

Knowledge Summary


No data available


  Disease (5)

Disease Target Count Z-score Confidence
Barrett Esophagus 16 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.286 1.6
Disease Target Count
Barrett's esophagus 182


  Differential Expression (35)

Disease log2 FC p
acute myeloid leukemia -1.300 2.1e-02
acute quadriplegic myopathy 1.748 1.2e-03
adrenocortical carcinoma 2.125 1.7e-02
adult high grade glioma 2.200 1.8e-03
astrocytic glioma -1.400 4.7e-02
Astrocytoma, Pilocytic 4.000 3.3e-13
Atopic dermatitis -2.200 2.9e-03
atypical teratoid / rhabdoid tumor 2.100 6.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.355 1.2e-02
Becker muscular dystrophy 1.039 4.1e-02
Breast cancer 4.200 3.5e-02
breast carcinoma 1.300 3.9e-04
cystic fibrosis 1.288 2.4e-04
Duchenne muscular dystrophy 2.061 5.4e-08
ductal carcinoma in situ 2.000 6.7e-03
ependymoma 1.200 6.9e-03
gastric carcinoma 4.100 1.1e-02
glioblastoma 3.300 2.4e-08
group 3 medulloblastoma 3.300 4.0e-07
interstitial cystitis 1.700 8.9e-03
invasive ductal carcinoma 3.072 2.6e-05
juvenile dermatomyositis 2.325 3.0e-12
limb girdle muscular dystrophy 2A 1.570 7.3e-05
lung adenocarcinoma 1.500 6.4e-18
medulloblastoma, large-cell 1.700 4.0e-03
nasopharyngeal carcinoma 1.400 2.2e-02
non-small cell lung cancer 3.628 5.5e-24
oligodendroglioma -1.400 2.5e-02
osteosarcoma 3.825 1.5e-06
ovarian cancer 4.500 9.2e-06
pancreatic cancer 2.400 2.7e-04
pituitary cancer -1.200 2.1e-03
primary pancreatic ductal adenocarcinoma 5.406 7.6e-06
ulcerative colitis 3.600 1.0e-04
urothelial carcinoma 2.400 2.8e-02

Gene RIF (40)

AA Sequence

VAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK                                         211 - 243

Text Mined References (45)

PMID Year Title