Property Summary

NCBI Gene PubMed Count 69
PubMed Score 450.14
PubTator Score 90.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
interstitial lung disease -1.600 7.2e-03
malignant mesothelioma 3.100 8.3e-09
oligodendroglioma -1.100 5.0e-02
group 3 medulloblastoma -1.700 7.2e-04
adrenocortical carcinoma -4.657 3.7e-16
tuberculosis -2.300 3.5e-07
pancreatic ductal adenocarcinoma liver m... -2.354 1.9e-02
X-linked cerebral adrenoleukodystrophy 2.200 4.2e-02
pancreatic cancer -1.300 5.6e-03
adult high grade glioma -1.200 2.4e-03
MYELODYSPLASTIC SYNDROME -2.200 2.4e-02
gastric carcinoma -1.200 7.2e-03

Protein-protein Interaction (4)

Gene RIF (58)

PMID Text
26772887 Our study demonstrates that CSE/H2S system is regulated by miR-216a, and regulates ABCA1-mediated cholesterol efflux and cholesterol levels through the PI3K/AKT pathway.
26727544 Collectively, our findings indicate that radiation could promote HCC cell invasion through EMT mediated by endogenous H2S/CSE signaling via the p38MAPK pathway.
26620565 Nox4 is a positive transcriptional regulator of cystathionine-gamma-lyase in endothelial cells.
26519030 3-Mercaptopyruvate sulphurtransferase and not cystathionine gamma-lyase is the primary regulator of coronary artery hydrogen sulfide production and function.
26060478 The expression of CSE was positively correlated with the severity of gastric ulcer
25934094 GPBAR1 plays a role in secondary bile acid induced vasodilation via reglation of cystathionine gamma-lyase. The GPBAR1/CSE pathway might contribute to endothelial dysfunction and hyperdynamic circulation in liver cirrhosis.
25807836 CTH observed relationship between the rs482843 polymorphism and the risk of preeclampsia.
25801727 An increase of placental mRNA levels in the pre-eclampsia group was observed for methionine synthase and cystathionine gamma-lyase.
25486189 Substantial portion of Huntington's disease neurotoxicity appears to be attributable to cystathionine gamma-lyase deficiency.
25205294 The l-cysteine/cystathionine gamma lyase/hydrogen sulfide pathway is involved in melanoma progression.
25203395 The miR-30 family are potentially important regulators of cystathionine gamma-lyase gene expression.
25193114 Wnt pathway regulates CSE gene expression on transcriptional level and CSE/hydrogen sulfide plays important roles in colon cancer.
24914509 CTH is distributed in the human fallopian tube epithelium.
24896355 Studies indicate taht a number of transcript factors regulate cystathionine gamma-lyase (CSE) transcription through direct or indirect binding with CSE promoter.
24866963 our data suggest that the NF-kappaB binding site on CSE promoter is critical for LPS-induced CSE expression in mammalian cells.
24707893 results of the present study provide molecular insights into the antioxidative activity of CSE and highlights the importance of the CSE/H2S system in maintaining cellular glutathione status
24657251 These results demonstrate that H2S/CSE and its downstream pathway contribute to the proliferation of hepatoma cells, and inhibition of this pathway strongly suppress the excessive growth of hepatoma cells by stimulating mitochondrial apoptosis
24610811 demonstrates for the first time that both hyperglycemia and hyperketonemia mediate a reduction in CSE expression and activity, which can contribute to the impaired H2S signaling associated with diabetes
24491890 Overexpression of the gene encoding CTH in cells leads to increased production of H2S, which plays a role in neuron protection against oxidative stress, and stimulates increase in gamma-glutamylcysteine synthetase and an increase in level of GSH. (review)
23852134 The up-regulation of cystathionine gamma-lyase expression during hypoxia may be useful for increasing the production and concentration of H2S in mammalian cells and indirectly protecting cells from hypoxia.
23704251 Endogenous H2S is required for healthy placental vasculature, and a decrease in cystathionine gamma-lyase/H2S activity may contribute to the pathogenesis of preeclampsia.
23410520 MicroRNA-21, which negatively regulates CSE expression, was increased in placentas with abnormal Doppler waveforms.
23393010 Transgenic CTH plays a critical role in the preservation of cardiac function following transverse aortic constriction, i.e., in the setting of pressure overload-induced heart failure.
22360859 PI3K/AKT pathway increased the activity of cystathionine gamma-lyase gene promoter via Sp1.
22310774 CTH is present in prostatic tissues and both normal and malignant prostate cell lines, including stromal compartments and the stromal cell line WPMY-1. It is downregulated by dihydrotestosterone.
22034194 Take together, these results suggest that miR-21 participates in CSE/H(2)S-mediated-SMC differentiation by targeting SP1.
21886822 H(2)S generated by CSE and CBS locally exerts dual effects on the contractility of pregnant myometrium
21659522 transcript factor Sp1 is a critical regulator of the hCSE expression during SMC differentiation, and CSE/H(2)S system is essential for maintenance of SMC phenotype.
21507721 CTH 1208 GT genotype was associated with increased chance of pregnancy and smaller number of previously failed IVF cycles and genotype frequency was lower in IVF patients with three or more previously failed IVF treatments compared with fertile controls
20849728 The increased expression of cystathionine-gamma-lyase(CSE)/H2S pathway might be involved in the pathogenesis of viral myocarditis.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20584029 the CTH p.T67I substitution could have an ancient common origin, which probably occurred in the Neolithic Era and spread throughout Europe.
20446008 The investigations could aim at verifying whether the stimulation of CST, at the level of protein or gene expression, could change the proliferation of neoplastic cells.
20175737 Cystathionine beta-synthase 844Ins68 polymorphism is not associated with the levels of homocysteine and cysteine in an Indian population
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19531479 cystathionine beta-synthase and gamma-cystathionase have roles in H2S biogenesis via alternative trans-sulfuration reactions
19428278 no evidence that severe loss of CTH activity due to the mutations is accompanied by adverse clinical effects
19418582 These results demonstrate that cystathionase is a farnesoid X receptor-regulated gene and provide a new molecular explanation for the pathophysiology of portal hypertension.
19324355 Observational study of gene-disease association. (HuGE Navigator)
19261609 H2S biogenesis by human cystathionine gamma-lyase leads to the novel sulfur metabolites lanthionine and homolanthionine and is responsive to the grade of hyperhomocysteinemia
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019829 structure of hCSE.PLP.PAG complex highlights the particular importance of Tyr(114) in hCSE and the mechanism of PAG-dependent inhibition of hCSE
18988749 Observational study of genetic testing. (HuGE Navigator)
18849566 porphyrin moiety of the heme plays a critical role in proper CBS folding and assembly, but the metal ion is not essential for this function or for allosteric regulation by S-adenosyl-L-methionine
18701025 The present study suggests that the SNPs rs482843 and rs1021737 of the CTH gene were not associated with essential hypertension in the Northern Chinese Han population.
18701025 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18476726 Mutations weaken the affinity for pyridoxal-5-phosphate and suggest that cystathionuric patients with these mutations should be responsive to pyridoxine therapy.
17311259 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15347670 Cystathionine gamma-lyase has a role in regulating cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1
15151507 Observational study of gene-disease association. (HuGE Navigator)
12574942 two nonsense mutations, namely exon 8 c.940-941delCT and exon 11 c.1220delC, and two missense mutations, namely exon 2 c.356C>T (T67I) and exon 7 c.874C>G (Q240E)were found in four probands with cystathioninuria

AA Sequence

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC      1 - 70
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI     71 - 140
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA    141 - 210
TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL    211 - 280
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL    281 - 350
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS                   351 - 405
//

Text Mined References (72)

PMID Year Title
26772887 2016 Cystathionine ?-lyase(CSE)/hydrogen sulfide system is regulated by miR-216a and influences cholesterol efflux in macrophages via the PI3K/AKT/ABCA1 pathway.
26727544 2016 Radiation Exposure Promotes Hepatocarcinoma Cell Invasion through Epithelial Mesenchymal Transition Mediated by H2S/CSE Pathway.
26620565 2016 Transcriptional Regulation of Cystathionine-?-Lyase in Endothelial Cells by NADPH Oxidase 4-Dependent Signaling.
26519030 2016 MPST but not CSE is the primary regulator of hydrogen sulfide production and function in the coronary artery.
26060478 2014 Correlation between the cystathionine-?-lyase (CES) and the severity of peptic ulcer disease.
25934094 2015 Cystathionine ?-lyase, a H2S-generating enzyme, is a GPBAR1-regulated gene and contributes to vasodilation caused by secondary bile acids.
25807836 2015 The importance of rs1021737 and rs482843 polymorphisms of cystathionine gamma-lyase in the etiology of preeclampsia in the Caucasian population.
25801727 2015 The importance of MTHFR, MTR, MTRR and CSE expression levels in Caucasian women with preeclampsia.
25486189 2014 Neurodegeneration in Huntington's disease involves loss of cystathionine ?-lyase.
25416956 2014 A proteome-scale map of the human interactome network.
25205294 2015 Role of the cystathionine ? lyase/hydrogen sulfide pathway in human melanoma progression.
25203395 2015 miRNA-30 family inhibition protects against cardiac ischemic injury by regulating cystathionine-?-lyase expression.
25193114 2014 Wnt/?-catenin signaling induces the transcription of cystathionine-?-lyase, a stimulator of tumor in colon cancer.
24914509 2014 Dysregulation of hydrogen sulphide metabolism impairs oviductal transport of embryos.
24896355 2014 Regulation of cystathionine gamma-lyase/H?S system and its pathological implication.
24866963 2014 The binding site for the transcription factor, NF-?B, on the cystathionine ?-lyase promoter is critical for LPS-induced cystathionine ?-lyase expression.
24707893 2014 The cystathionine ?-lyase/hydrogen sulfide system maintains cellular glutathione status.
24657251 Hydrogen sulfide (H2S)/cystathionine ?-lyase (CSE) pathway contributes to the proliferation of hepatoma cells.
24610811 2014 Decreased cystathionine-?-lyase (CSE) activity in livers of type 1 diabetic rats and peripheral blood mononuclear cells (PBMC) of type 1 diabetic patients.
24491890 2014 [Cystathionine ?-lyase].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23852134 2014 Regulation of cystathionine ?-lyase in mammalian cells by hypoxia.
23704251 2013 Dysregulation of hydrogen sulfide producing enzyme cystathionine ?-lyase contributes to maternal hypertension and placental abnormalities in preeclampsia.
23410520 2013 Reduced cystathionine ?-lyase and increased miR-21 expression are associated with increased vascular resistance in growth-restricted pregnancies: hydrogen sulfide as a placental vasodilator.
23393010 2013 H?S protects against pressure overload-induced heart failure via upregulation of endothelial nitric oxide synthase.
22360859 2012 Sp1 is involved in regulation of cystathionine ?-lyase gene expression and biological function by PI3K/Akt pathway in human hepatocellular carcinoma cell lines.
22310774 2012 Characterization of hydrogen sulfide and its synthases, cystathionine ?-synthase and cystathionine ?-lyase, in human prostatic tissue and cells.
22169477 2011 H2S-Induced sulfhydration of the phosphatase PTP1B and its role in the endoplasmic reticulum stress response.
22034194 2012 MicroRNA-21 represses human cystathionine gamma-lyase expression by targeting at specificity protein-1 in smooth muscle cells.
21886822 2011 Expression of cystathionine ?-synthase and cystathionine ?-lyase in human pregnant myometrium and their roles in the control of uterine contractility.
21659522 2011 Specificity protein-1 as a critical regulator of human cystathionine gamma-lyase in smooth muscle cells.
21507721 2011 Folate-metabolizing gene variants and pregnancy outcome of IVF.
21269460 2011 Initial characterization of the human central proteome.
20849728 2010 [Expression of cystathionine-?-lyase/hydrogen sulfide pathway in CVB3-induced myocarditis in mice].
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20584029 2010 Ancient origin of the CTH alelle carrying the c.200C>T (p.T67I) variant in patients with cystathioninuria.
20446008 2011 The expression and activity of cystathionine-?-lyase and 3-mercaptopyruvate sulfurtransferase in human neoplastic cell lines.
20175737 2010 Cystathionine beta-synthase 844Ins68 polymorphism is not associated with the levels of homocysteine and cysteine in an Indian population.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19531479 2009 Relative contributions of cystathionine beta-synthase and gamma-cystathionase to H2S biogenesis via alternative trans-sulfuration reactions.
19428278 2009 Cystathionine gamma-lyase: Clinical, metabolic, genetic, and structural studies.
19418582 2009 Bile-acid-activated farnesoid X receptor regulates hydrogen sulfide production and hepatic microcirculation.
19324355 2010 Variations in folate pathway genes are associated with unexplained female infertility.
19261609 2009 H2S biogenesis by human cystathionine gamma-lyase leads to the novel sulfur metabolites lanthionine and homolanthionine and is responsive to the grade of hyperhomocysteinemia.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19019829 2009 Structural basis for the inhibition mechanism of human cystathionine gamma-lyase, an enzyme responsible for the production of H(2)S.
18988749 2009 MALDI-TOF MS genotyping of polymorphisms related to 1-carbon metabolism using common and mass-modified terminators.
18849566 2008 Active cystathionine beta-synthase can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone.
18701025 2008 Relationship between cystathionine gamma-lyase gene polymorphism and essential hypertension in Northern Chinese Han population.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18476726 2008 Kinetic properties of polymorphic variants and pathogenic mutants in human cystathionine gamma-lyase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17311259 2007 Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15347670 2004 Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1.
15151507 2004 Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12574942 2003 Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10212249 1999 Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1339280 1992 Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase.