Property Summary

NCBI Gene PubMed Count 433
PubMed Score 1870.46
PubTator Score 997.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -1.700 2.8e-07
ependymoma 2.500 1.1e-02
glioblastoma 2.300 1.3e-02
atypical teratoid / rhabdoid tumor 1.700 6.9e-03
Duchenne muscular dystrophy 1.223 4.8e-04
limb girdle muscular dystrophy 2I 1.498 7.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.903 4.9e-03
Becker muscular dystrophy 1.141 4.8e-02
juvenile dermatomyositis 1.182 3.8e-05
Atopic dermatitis -1.500 2.3e-02
adrenocortical carcinoma -2.445 5.0e-03
primary pancreatic ductal adenocarcinoma 3.145 5.3e-05
intraductal papillary-mucinous adenoma (... -1.900 3.0e-02
intraductal papillary-mucinous carcinoma... -2.800 2.9e-03
ulcerative colitis 1.900 2.4e-04
Obesity 1.200 3.3e-02
diabetes mellitus -1.600 3.6e-02
interstitial cystitis 1.900 3.1e-03
cystic fibrosis 2.700 5.9e-04
lung adenocarcinoma -2.100 2.1e-08
nasopharyngeal carcinoma -1.700 1.5e-04
psoriasis -1.300 2.9e-04
lung carcinoma -2.400 2.6e-16
spina bifida -2.193 3.9e-02
Breast cancer 1.200 1.4e-02
gastric carcinoma 2.500 1.1e-02
ovarian cancer 3.600 1.3e-05
pituitary cancer -2.100 2.0e-04
pancreatic cancer 2.700 1.1e-04

Protein-protein Interaction (8)

Gene RIF (418)

PMID Text
26909983 The gradual increase of CTGF and TGF-beta1 expression levels in liver tissue is associated with liver fibrosis. Early expression of CTGF and TGF-beta1 in biliary epithelial cells may be involved in the pathogenesis of congenital biliary atresia.
26719893 TGF-beta and CCN2 play an important role in IUA formation.
26707502 small interfering RNAmediated silencing of CTGF promoted cell death and suppressed osteosarcoma cell migration and invasion.
26577677 Findings suggest that GDF8 and CTGF may play critical roles in the regulation of proliferative events in human granulosa cells.
26575166 In high-grade serous ovarian tumors the highest level of tumor stromal CTGF expression was correlated with the poorest prognosis. Identify CTGF as a promoter of peritoneal adhesion, likely to mediate metastasis, and a potential therapeutic target in high-grade serous ovarian cancer.
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26421309 renoprotective therapeutic agents can specifically abolish CCN2 expression in diabetic nephropathy; CCN2 plays a pivotal role in disease progression [review]
26318291 CTGF was able to induce tumor cell epithelial-mesenchymal transition (EMT), and promote stroma deposition of collagen I fibers to stimulate tumor growth and metastasis.
26218313 Report opposing effects of CCN2 and CCN5 on fibroblast proliferation and transdifferentiation induced by TGF-beta.
26192087 Studied how rapamycin affects CCN2 expression and migration of lung fibroblasts in vitro; PI3K and inhibitors were used to determine rapamycin's mechanism of action.
26171399 Data suggest that, in patients with type 1 diabetes mellitus and diabetic nephropathy, up-regulation of urinary CTGF level is independently associated with biomarkers of proximal and distal tubular dysfunction and pathology.
26138615 Novel variant encoding only the CT domain may play a role in pre-B ALL tumorigenesis and/or progression.
25955392 Results showed that CTGF were expressed in human granulosa cells and up-regulated by TGF-beta1 through the activation of Smad and ERK1/2 signaling pathway.
25940705 TAZ promotes neuroblastoma cell proliferation and tumorigenicity through up-regulating the expression of CTGF genes.
25916872 High Connective tissue growth factor expression is associated with the cicatrization of cellular crescents in ANCA-associated glomerulonephritis.
25899830 our results argue that MZF-1 regulates the CTGF and NOV genes in the hematopoietic compartment, and may be involved in their respective functions in the stroma.
25847507 The rs928501 was associated with exfoliation syndrome without and with glaucoma (p = 0.016 and 0.018, respectively.
25847009 The expression of CTGF is an independent factor associated with shorter overall survival in hepatocellular carcinoma.
25779637 Data show that variations in the expression of periostin and CCN2 are related to an inflammatory microenvironment and the presence of TNFalpha in human chronic wounds.
25761878 Our data indicated that downregulation of miR-26b in osteosarcoma elevated the levels of CTGF and Smad1, facilitating osteosarcoma metastasis
25738829 stromal CTGF expression was seen in a high percentage of male breast cancer
25727552 Pulsed dye laser can effectively suppress the growth of keloids and significantly down-regulate CTGF mRNA and CTGF expression.
25727481 Data describe a novel SMAD-binding element located in the 5'UTR region of the murine CTGF gene that regulates the expression of CTGF induced by TGF-b in C2C12 myoblast cell line, which involves SMAD3 and SP1/SP3 transcription factors.
25704370 Data suggest that an increased level of connective tissue growth factor (CTGF) appears to protect trabecular meshwork (TM) cells against damage induced by stress.
25647524 CTGF is responsible for the observed effects of GPER on cancer-associated fibriblast activation and breast cancer invasion.
25601519 TGF-beta2 dependent upregulation of S1P5 is required for the induction of pro-fibrotic CTGF by TGF-beta in mesangial cells.
25502877 the rs6918698 GG genotype is associated with an increased risk of developing colon carcinoma, and genetic variations at the rs6918698 are associated with the growth pattern of the tumor.
25501363 CTGF expression was negatively regulated by miR133b in the human colorectum, suggesting that miR133b and CTGF may be candidate therapeutic targets in colorectal cancer.
25495560 identify autophagy as a novel activator of MTORC2 signaling leading to connective tissue growth factor induction and myofibroblast differentiation
25478966 Based on these findings, anti-CTGF scFv dimer may be a potential agent for the prevention of airway remodeling in asthma.
25384022 increased peritoneal expression of connective tissue growth factor (CCN2), transforming growth factor-beta1, and vascular endothelial growth factor in encapsulating peritoneal sclerosis encapsulating peritoneal sclerosis
25349161 homozygosity of promoter-activating G allele in the CTGF_c.-945C>G variant is overrepresented in recovered heart failure patients with mechanical circulatory support
25341039 CTGF activates PI3K, AKT, ERK, and NF-kappaB/ELK1 pathway, leading to the upregulation of miR-210, promoting HIF-1alpha-dependent VEGF expression and angiogenesis in human synovial fibroblasts.
25261584 These findings indicate that CCN2 promotes proliferation and early differentiation but inhibits the terminal differentiation of myoblasts, thus suggesting that CCN2 plays a physiological role in myogenesis.
25203810 highly expressed in ductular reactions of cirrhotic livers and cholangiocarcinoma
25150958 hCTGF-induced tube formation and stimulated production of interleukin-8, an important angiogenic factor, in first trimester human placental trophoblast cells.
25126747 Expression of CCN2, EMA, and FAP may be involved in the activation of cancer associated fibroblasts in hepatocellular carcinoma.
25121739 suggest that CXCL12, acting through CXCR4, activates the Rac/ERK and JNK signaling pathways, which in turn initiates c-Jun phosphorylation, and recruits c-Jun and c-Fos to the CTGF promoter
25111595 In patients with schistosomiasis japonica, TGF-beta1 participates not only in the inflammatory process, but also in the fibrotic process in which Hsp47 and CTGF probably play a key role.
25030555 A CTGF -945 C homozygote status is a significant risk factor for the progression of HCV-related chronic liver disease
25003330 Data show CTGF elevating MMPs expression and subsequently promoting tumor metastasis in human osteosarcoma, down-regulating miR-519d via MEK and ERK pathways.
24985492 The role of CTGF in the gastric cancer peritoneal metastasis:CTGF blocks integrin alpha3beta1-dependent adhesion of cancer cells.
24973271 Plasma CTGF may be a potential biomarker for stable asthma when evaluating the degree of persistent airway obstruction.
24933320 the SSc epidermis provides an important source of pro-fibrotic CCN2 and proinflammatory S100A9 in SSc skin, and therefore contributes to the fibrosis and inflammation seen in the disease
24882759 CCN2 is packaged into secreted, nano-sized exosomes that mediate its intercellular transfer between hepatic stellate cells.
24828686 They also antagonized the TGF-beta1 induced up-regulation of CTGF and transgelin.
24758915 The expression of CTGF and its regulation by ceramide and TGF-beta, was examined.
24755068 TGF-beta2, CTGF and gremlin are all involved in epithelial mesenchymal transition and extracellular matrix synthesis via activation of Smad signaling pathway in lens epithelial cells.
24703458 The CTGF and RFP-coexpressing renal tubular epithelial cell, HK-C2AR, could be used to quantitatively evaluate CTGF-specific small interfering RNAs on EMT by quantitatively detecting the RFP expression.
24700237 It plays critical roles in the tumorigenesis of several human malignancies and indeendent prognostic factor in stage IV head and neck squaous cell cancer.
24689870 Under treatment with MMC and hydrostatic pressure, UC cells showed increasing apoptosis using extrinsic pathways through upregulation of TLR6 and CTGF
24676352 DNA methylation is a regulatory mechanism of CTGF expression, which is decreased in patients with DM, particularly in those with DN, and may contribute to the pathogenesis of nephropathy.
24597264 expression of the antioxidase glutathione peroxidase 1 in pelvic support structure of pelvic organ prolapse women was decreased, which resulted in the antioxidation reduced and may induce down-regulation of transforming growth factor-beta1-CTGF pathway
24577260 CTGF gene expression showed only a tendency in in chronic glomerulonephritis
24560449 Cyclosporine A may contribute to the pathogenesis of gingival overgrowth through upregulation of CCN2 expression in gingival fibroblasts.
24503185 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24485923 we report that YAP and its downstream transcriptional targets CCN1 and CCN2 are markedly elevated in keratinocytes in human skin basal cell carcinoma
24464932 Plasma CTGF was increased in patients with more severe diastolic heart failure and myocardial fibrosis.
24464580 CCN2 and inflammatory cytokines form a functional negative feedback loop in NP cells involving interleukin-1beta through alpha5beta1 and alphaVbeta3 integrins that may be important in the pathogenesis of disc disease
24462773 data indicate that CTGF might be a critical oncogene of human osteosarcoma involved in resistance to paclitaxel treatment
24413988 when CTGF expression was maintained, the inhibitory effect of BMP9 on the MDA-MB-231 cells was abolished.
24269276 This study aims to discover a more robust and effective CCN2 derivative to induce regeneration.
24154679 Data suggest that CTGF is highly expressed in primary precursor B-ALL cells from pediatric patients with acute lymphoblastic leukemia; CTGF knockdown exhibits anti-leukemia effects.
24146089 CTGF measurements might lead to a better discrimination of higher functional and structural heart failure stages and might identify patients of an increased risk for an acute cardiac decompensation.
24122827 Exosomal transfer of miR-214 is a paradigm for the regulation of CCN2-dependent fibrogenesis and identifies fibrotic pathways as targets of intercellular regulation by exosomal miRs.
24121259 These data implicate the rs6918698GG genotype with an age of disease onset of greater than 40 years in Crohn's disease whereas the rs9402373CC genotype is associated with a nonstricturing, nonpenetrating disease phenotype.
24112732 found that rCCN2 stimulated proliferation in dental mesenchyme in a dose-dependent manner. Together, the data indicate that expression of CCN genes is spatio-temporally regulated in developing tooth germs.
24090133 Breast tumour cells down-regulate CCN2 gene expression in co-cultured fibroblasts in a Smad7- and ERK-dependent manner.
24079812 CCN2 was transiently expressed at the leading keratinocyte edge in wound healing.
24074434 CTGF induced the phenotype transition of tenon capsure fibroblasts individually and significantly promoted their proliferation it also demonstrated its role as a crucial factor in fibrosis.
24035571 Sphingosine-1-phosphate stimulates CCN2 protein production in human buccal fibroblasts. Constitutive CCN2 overexpression may enhance the profibrotic activity in oral submucous fibrosis.
24014274 These finding suggest that there is an increased expression of TGF-beta and CTGF, a TGF-beta regulated protein, and that this TGF-beta activation may be responsible for fibrosis in carpal tunnel syndrome patients.
24005672 The total CTGF production induced by TGF-beta in activated HSCs is therefore, to a large extent, dependent on the balance and integration of the canonical Smad3 and Stat3 signaling pathways
23988606 CCN2 enhances keratinocyte adhesion and migration through integrin alpha5beta1 and activation of the focal adhesionkinase-MAPK signaling cascade.
23847295 CTGF expression might play a role in the development of malignant tumors in the thyroid.
23824844 Similarly inhibits TGF-beta1-stimulated CCN2/CTGF expression.
23772794 Hypomethylation of the CTGF locus is an essential prerequisite for aberrant CTGF expression in pre-B ALL.
23755163 Reduced expression of CTGF promoted cell proliferation, migration, invasion and cell cycle progression through FAK/PI3K/AKT, epithelial-mesenchymal transition and MMP pathways in nasopharyngeal carcinoma.
23741006 The data suggest an important role of CTGF in mesenchymal stromal cells differentiation into adipocytes and of leptin in homing and progression of leukemia.
23727026 we found that TGF-beta induced expression of CTGF was not mediated by TGF-b activated Smad signaling but mediated by TGF-beta activated Erk, JNK and p38 MAPK signaling
23687336 Coexpression of CTGF and pluripotency genes is associated with a worse prognosis in head and neck squamous cell carcinoma.
23681229 CTGF-mediated upregulation of miR-18b was dependent on the increased binding of transcription factors.
23663495 Fli1 and CTGF are important mediators of the fibrogenic actions of adenosine
23648563 The C-terminal module of CCN2 induces the Th17 differentiation of human Th17 cells and causes a renal Th17 inflammatory response.
23631855 Tensile strain increases expression of CCN2 and COL2A1 by activating TGF-beta-Smad2/3 pathway in chondrocytic cells.
23593935 Knockdown of CTGF resulted in significant reduction in cell viability, colony formation and anchorage-independent growth (P < 0.05) in gallbladder cancer cells.
23582094 CTGF appears to be a key regulator of fibrosis during maladaptive remodeling and progression to heart failure.
23567513 CCN2 in the intervertebral disc is regulated by TGF-beta and hypoxia via HIF-1alpha, the critical determinants that characterize the disc microenvironment in health and disease. (Review)
23564449 hnRNP-K regulates extracellular matrix, cell motility, and angiogenesis pathways. Involvement of the selected genes (Cck, Mmp-3, Ptgs2, and Ctgf) and pathways was validated by gene-specific expression analysis
23530034 findings reveal a negative feedback loop between CCN2 and HIF-1alpha in NP cells and demonstrate a role for CCN2 in maintaining matrix homeostasis in this tissue.
23508392 Investigate collagen, CTGF and osteopontin ezpression in patients with ascending thoracic aortic aneurysms; results demonstrated that collagen, CTGF and osteopontin levels significantly increased in the ATAA group than in the control group.
23501329 CTGF expression in serum is an indicator of fibrogenic progression and malignant transformation in patients with chronic hepatitis B infection.
23494140 ERK and JNK signaling mediate CCN2-induced extracellular matrix protein production and hypertrophic scar formation.
23454256 IL-1alpha reduces CCN2 expression and increased TNC expression in human cardiac fibroblasts.
23435419 Anti-CTGF therapy for the treatment of advanced melanoma.
23414795 Two groups of CCN2 polymorphisms independently modulate the progression of hepatic fibrosis.
23390502 MiR-145 regulates glioma cell migration by targeting CTGF which downregulates SPARC expression.
23383241 Connective tissue growth factor (CTGF/CCN2) is negatively regulated during neuron-glioblastoma interaction.
23368866 CTGF expression showed a progressive increase from chronic cholecystitis to dysplasia and then to early and advanced carcinoma. Immunochemical expression was significantly higher in advanced tumors in comparison with chronic cholecystitis and dysplasia.
23323010 CCN2 has a role in the growth and metastasis of hepatocellular carcinoma
23307318 Enhanced production of CTGF is associated with hepatocellular carcinoma metastasis to bone.
23284892 Increased myocardial CTGF activities after MI are associated with attenuation of LV remodeling and improved LV function mediated by attenuation of inflammatory responses and inhibition of apoptosis.
23280549 A novel signaling pathway for GDF-15 through interaction with the matricellular signaling molecule CCN2.
23274856 our results indicated that CTGF enhances the migration of monocyte cells by increasing MCP-1 expression through the alphavbeta5 integrin, FAK, MEK, ERK, and NF-kappaB/AP-1 signal transduction pathway.
23227240 CTGF increased IL-6 production in osteoarthritic synovial fibroblasts via the alphavbeta5 integrin, ASK1, p38/JNK, and AP-1/NF-kappaB signaling pathways.
23175185 CCN family protein 2 induces ubiquitination-dependent degradation of EGFR by disrupting the beta-pix/c-casitas B-lineage lymphoma (c-Cbl) complex.
23142580 It was found that found that CCN2 could bind to fibroblast growth factor receptors 2 and 3, with a higher affinity towards 2. The binding of fibroblast growth factor receptor 2 to fibroblast growth factor 2 and 4 was enhanced by CCN2.
23108098 these results indicate that thrombin might activate c-Src to induce JAK2 activation, which in turn, causes STAT3 activation, and finally induces CCN2 expression in human lung fibroblasts.
23073116 These findings suggest that Connective tissue growth factor is not only an important mediator but potent activator of Epithelial to mesenchymal transition in peritoneal mesothelial cells, which in turn promotes gastric cancer cell adhesion to peritoneum.
23061738 Data suggest that urinary CCN3/CCN2 mRNA ratio may be a useful noninvasive biomarker for evaluating patients with nondiabetic chronic kidney disease (CKD) prior to renal biopsy.
23056332 studies demonstrate a central role for CTGF expression in HCV-induced liver fibrosis and highlight the potential value of developing CTGF-based anti-fibrotic therapies to counter HCV-induced liver damage
23055574 Findings suggest that OPN, HMGB1, and CTGF contribute to the pathogenesis of proliferative vitreoretinal disorders.
23044205 Ang (1-7) can inhibit the Ang II-stimulated up-regulation of RhoA, ROCK and CTGF in hepatic stellate cells.
23029004 Data demonstrated that CTGF was negatively regulated by IFN-gamma in LEC in a Jak/Stat signaling pathway-dependent manner.
22964303 Data suggest that the signaling elements IL-6, IL-8, OPN, TLN1, and CTGF are involved with NF-kappaB p65 in random positioning machine (RPM)-dependent thyroid carcinoma cell spheroid formation.
22918238 TGFbeta signaling together with intrinsic disturbances in neurofibromatosis type 2 (NF2) and Hippo signaling cascades in malignant mesothelioma cells converges upon further expression of connective tissue growth factor.
22906474 The -945CC/CG genotype greatly decreased the susceptibility of systemic sclerosis in Asians. Review.
22846210 Serum levels of CTGF may be a clinical utility for distinguishing nonalcoholic fatty liver disease patients with and without advanced fibrosis.
22814105 Together these results suggest that the inhibitory effect of OSM on TGF-beta1-induced CTGF mRNA expression is mainly driven by STAT3, thereby providing a signaling mechanism whereby OSM may contribute to tubulointerstitial protection.
22795353 Hypoxia induces pancreatic stellate cells secretion of CTGF, leading to enhancement of pancreatic cancer invasiveness.
22699679 Genistein attenuates advanced glycation end product-induced expression of fibronectin and connective tissue growth factor
22684333 The effects of CTGF expression on tumor formation are independent of its extracellular matrix function, but rather depend on its ability to activate catabolic metabolism.
22611323 Detection of serum CCN2 in patients with chronic hepatitis B may have clinical significance for assessment of severity of hepatic fibrosis.
22586581 hyperglycemia caused an induction of phosphorylated extracellular signal-related kinase 1/2 and Snail1 that was abrogated by silencing of TrkA or CCN2 using small interfering RNA
22576977 Mechanical stretch stimulates Smad3-dependent CCN2 transcription on chromatin and COL1A1 expression in human inner meniscus cells.
22539964 Identification of CCN2 as a downstream target of Ets-1 reveals a potential mechanism that may help unravel some of the effects of Ets-1 on osteoblast growth and differentiation.
22533709 In Caucasians with type 2 diabetes, genetic variation in the CTGF -945 G/C polymorphism is not associated with cardiac or kidney complications.
22532143 It conclude that in the murine atria, CCN1 and CCN2 proteins are expressed constitutively. In chronic heart failure, CCN proteins tend to be upregulated, which may be related to the action of angiotensin II.
22516997 TGF-beta1, CTGF, collagen I and collagen III were upregulated in sarcoiliac joints of ankylosing spondylitis patients.
22466886 is likely involved in reparative dentinogenesis through formation of hard tissue in human carious teeth
22454511 LRP1 mediates the transport of CCN2.
22438586 CCN2 regulation by antiproliferative factor involves CKAP4 nuclear translocation and binding to the CCN2 promoter.
22422617 Data suggest that sphingosine 1-phosphate receptor 1 transactivation is dependent on sphingosine kinase 1, is upstream of MAP kinase signaling system, and is required for LDL-regulated expression of CTGF in mesangial cells.
22416876 a positive correlation between plasma and synovial fluid CTGF levels and severity of knee osteoarthritis
22395513 TGF-beta1 has a crucial role in periodontal disease fibrogenesis by intensifying the action of CTGF
22363806 JNK mediates the expression of CTGF and corneal scarring in corneal wound healing.
22350758 NRG1 is involved in fibrotic scar pathogenesis via PI3 kinase- or Src-mediated CTGF expression.
22340243 Knockdown of CTGF may be a potential therapeutic strategy for treatment of hepatocellular carcinoma.
22335903 CTGF is overexpressed in both pancreatic cancer cells in vitro and in vivo, indicating that it may play an important role in the cell proliferation and migration in pancreatic cancer.
22328559 CTGF is increased in the human endometrium at the time of endometrial repair post-menses.
22205539 High intratumoral CTGF and intratumoral IL-11 expression were associated with progression-free survival and overall survival after hepatectomy.
22134873 results strongly suggest that MMP-3 induces CTGF/CCN2 production independently of the protease activity of MMP-3 and dependently on dynamin-related endocytosis
22099397 CTGF is rapidly induced by TGF-beta1 already 1h after stimulation and reduced by BMP-7 application. Smad1/Smad5 or Id1/2 overexpression reduced the TGF-beta1-mediated expression of CTGF.
22045431 the polymorphism rs9493150 in the 5'-untranslated region of the connective tissue growth factor gene has no association with type 2 diabetes mellitus and surrogate markers of beta-cell area
21955589 connective tissue growth factor plays an important role in cell growth and invasion in human gastric cancer and it appears to be a potential prognostic marker for patients with gastric cancer
21946149 the mechanisms mediating suppression of CTGF by adiponectin were analyzed in detail
21928342 Data show that Wif-1 can interfere with CTGF-dependent induction of gene expression in primary murine chondrocytes, and indicate that Wif-1 may be a multifunctional modulator of signalling pathways in the cartilage compartment.
21927029 A reverse correlation between CTGF and miR-504, miR-504 and FOXP1, and a positive correlation between CTGF and FOXP1 were shown.
21907704 extracellular acidification induces CTGF production through the OGR1/G(q/11) protein and inositol-1,4,5-trisphosphate-induced Ca(2+) mobilization in human airway smooth muscle cells.
21864521 plasma CCN2 levels showed significantly negative correlation with 6-month change of forced vital capacity (FVC) in patients with IPF. CONCLUSIONS: Plasma CCN2 is a potential biomarker for IPF
21800344 CTGF down-regulated tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor 2 expression and was involved in the reduced sensitivity of these cells toward TRAIL-mediated apoptosis.
21784839 Urinary and plasma CTGF are elevated in nondiabetic chronic kidney disease. Only urinary CTGF is normalized by antiproteinuric intervention.
21771732 A CTGF-rich microenvironment facilitates CTGF-ITGB1-TrkA complex activation in TIC/TSCs, thereby increasing the invasiveness of malignant gliomas.
21760921 This study defines a novel CCN2/alpha(v)beta(3) integrin/Src/Smad1 axis that contributes to the pro-fibrotic TGF-beta signaling.
21747166 p53 induces CTGF expression and promotes liver fibrosis
21673687 CTGF promotes melanoma cell invasion and migration and, therefore, has an important role in the progression of malignant melanoma.
21659659 CTGF antagonism may offer a novel therapeutic strategy to alleviate BPD and PH in neonates.
21654839 Overexpression of PTEN reduces the overexpression of type I collagen and CCN2 by dSSc fibroblasts
21629692 Results suggested the transcriptional regulation of estrogen signaling through interaction between CTGF and ER, and thus may provide a novel mechanism by which cross-talk between secreted growth factor and ER signaling pathways occurs.
21611193 CCN2 mRNA and protein was induced by strain, which caused Strain caused the rapid activation of latent TGFbeta.
21609598 AngII significantly increased the expression of CTGF mRNA in embryonic lung fibroblasts via the RhoA-ROCK pathway.
21609573 increased expression of aortic CTGF in ascending thoracic aortic aneurysm specimens
21576830 Atrial fibrillation patients and animals exhibited a significantly increased expression of connective tissue growth factor (CTGF). Angiotension II-induced CTGF expression might be involved in atrial substrate remodeling.
21569762 these results suggest that distinct biological function of stretch-induced CCN2/CTGF might regulate region-specific phenotypes of anterior cruciate ligament-derived cells.
21558398 CTGF acts as a molecular predictor of peritoneal carcinomatosis (PC) and could be a potential therapeutic target for the chemoprevention and treatment of PC in colorectal cancer patients.
21548990 the -945GC SNP does not affect plasma CTGF levels, incidence and prognosis of diabetic nephropathy, and cardiovascular outcome
21503841 Our data suggest that CTGF plays an important role in papillary thyroid carcinoma progression by supporting tumor cell survival and drug resistance
21501375 CTGF and TSP-1 expression are elevated in human heart failure.
21484860 Increased expression of CTGF is associated with hypertrophy of the ligamentum flavum in patients with lumbar spinal stenosis.
21455569 MCF-7 cells stably expressing full-length CCN2 demonstrated reduced cell proliferation, increased migration in Boyden chamber assays and promoted angiogenesis in chorioallantoic membrane assays.
21424084 Activation of liver cells causes an increased synthesis of TGF-beta1 followed by a CTGF overproduction in various polymorphic hepatic structures, in accordance with the degree of fibrosis.
21352962 CTGF reduced the migration and expression of COX-2 in human oral cancer cells.
21349946 Findings define the TAZ-TEAD-Cyr61/CTGF signaling pathway as an important modifier of the Taxol response in breast cancer cells.
21265091 Hypoxia significantly up-regulated the expression of protein and mRNA of CTGF and increased the secretion of Col I in embryonic fibroblasts.
21245987 CCN2/CTGF is identified as a hepatocellular negative acute phase protein which is down-regulated by IL-6 via the STAT3 pathway through interaction on the DNA binding level
21245951 CTGF potentially acts as a modulating factor in inflammatory and wound healing response in fibroblasts of the human eye
21236242 the glycolytic enzyme GAPDH regulates the gene expression of ccn2 mRNA in trans by acting as a sensor of oxidative stress and redox signals, leading to CCN2 overexpression under the condition of hypoxia and promotion of angiogenesis.
21209863 Recombinant expression, purification, and functional characterisation of connective tissue growth factor and nephroblastoma-overexpressed protein
21166920 CTGF/CCN2 may be an important mediator of S1P-induced physiological and pathological angiogenesis
21098624 CTGF expression in early pregnancy decidua is regulated by PROK1, via activation of the Gq, PLC, cSrc, EGFR, MAPK/ERK kinase pathway and has a role in cell adhesion.
21081514 Upregulation of Cyr61 and CTGF gene expression in colorectal cancer suggests they have a role in tumour initiation or development but not as highly expressed in advanced stages suggesting their role may be important at an early stage of tumour development
21071938 CCN2 gene polymorphism is a prognostic risk factor for cardiovascular morbidity and mortality in hemodialysis patients.
21071938 Observational study of gene-disease association. (HuGE Navigator)
21054221 Myofibroblast transformation induced by transforming growth factor-beta1 is dependent on CTGF activation.
20971063 These data provide the first evidence that CTGF is a novel substrate of ADAM28 and suggest that ADAM28 may promote VEGF(165)-induced angiogenesis in the breast carcinomas by the CTGF digestion in the CTGF/VEGF(165) complex.
20966418 CTGF levels are associated with a more stable plaque phenotype
20840672 Connective tissue growth factor expression is increased in collagenous colitis and coeliac disease
20814177 CTGF cooperates with FN in enhancing the attachment and migration of corneal epithelial cells.
20731800 The regulation of connective tissue growth factor, collagen I and III, fibronectin, plasmin system regulators, matrix metalloproteinases and their inhibitors as well as alpha-smooth muscle actin was consistent with a suppression of ECM
20697347 found that MUC1 reorganizes transcription factor occupancy of genomic regions upstream of the CTGF gene
20689330 Glomerulosclerosis, tubulointerstitial fibrosis, and arterial media hypertrophy lesions of hypertensive nephrosclerosis are all characterized by increased CTGF tissue expression, which is associated with a concomitant increase in CTGF in blood and urine.
20685720 Downregulation of CTGF is associated with recurrence in meningiomas.
20660557 Study supports a potential role for CTGF in myofibroblast-mediated fibrosis associated with ileal carcinoids, and indicates that CTGF should be investigated as a target for future therapy.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20613589 Microarray analysis showed CTGF was highly expressed in early osteogenesis when comparing levels at day 1 with those at day 3.
20576680 Coordinated expression of TGF-beta isoforms and of CTGF may be involved in normal glomerulogenesis and possibly in maintenance of glomerular structure and function at adult age.
20522536 Treatment of microalbuminuric diabetic kidney disease using an anti-CTGF monoclonal antibody (FG-3019) was well tolerated and associated with a decrease in albuminuria.
20522428 Findings provide the first evidence that variants within the promoter region of the CTGF/CCN2 gene predisposes diabetic subjects to develop albuminuria.
20522428 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20305691 miR-17-92 and its target CTGF mediate effects of differentiation-promoting treatment on glioblastoma cells through multiple regulatory pathways.
20238043 There may be abnormal CTGF synthesis regulation in Age-related macular degeneration.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237235 Filtered CTGF is normally reabsorbed almost completely in proximal tubules via megalin, and elevated urinary CTGF may largely reflect proximal tubular dysfunction.
20222112 This study is the first to show that TGF-beta induces CTGF expression through activation of Smad3 and activator protein 1 (AP-1) signaling pathways in nucleus pulposus cells.
20201953 In dermal fibroblasts, CCN2 is required for the induction of MMP1 following Akt inhibition. CCN2 induces MMP1 expression via an Erk1/2 and Ets1-dependent pathway.
20180416 Estradiol may induce hypospadias by upregulating the expressions of ATF3 and CTGF.
20162579 Overexpression of CTGF caused the U343 glioblastom multiforme cells to survive for longer than 40 days in serum-free medium
20117462 In atrial fibrillation, angiotensin II activates CTGF via activation of Rac1 and nicotinamide adenine dinucleotide phosphate oxidase, leading to up-regulation of Cx43, N-cadherin, and interstitial fibrosis.
20056838 Fascin regulates the proliferation and invasiveness of ESCC cells by modulating the expression of CTGF and CYR61 via TGF-beta pathway.
20053285 plasma CCN2 has a role in right ventricular dysfunction and valvular regurgitation in neuroendocrine tumor patients
20050020 CTGF is preferentially expressed by human bulge cells, compared to differentiated hair follicle keratinocytes
20032117 Exposure to hypoxia decreased CTGF gene expression in cultured human tubular epithelial cells.
20032097 CTGF gene polymorphisms may contribute to susceptibility to scleroderma.
20032097 Observational study of gene-disease association. (HuGE Navigator)
20018872 Exposure to low oxygen tension or treatment with the hypoxia-mimetic dimethyloxalyl glycine (DMOG) stabilized HIF-1alpha and up-regulated CTGF in human umbilical vein endothelial cells and in a murine microvascular endothelial cell line.
20015945 Dialysate CTGF concentration could be a biomarker for both peritoneal fibrosis and membrane function in peritoneal dialysis patients.
20004937 Observational study of gene-disease association. (HuGE Navigator)
19955828 we discuss the biology of CCN2 with a focus on the regulation of CCN2 gene, cellular mechanisms of profibrotic CCN2 effects and the current in vivo and in vitro evidence for the role of CCN2 in the development of renal fibrosis[review]
19922639 aberrant connective tissue growth factor production induced by TNFalpha plays a central role for the abnormal osteoclastic activation in RA patients.
19895313 CTGF is involved in the wound-healing process and plays an important role in the pathogenesis of intraocular proliferative diseases.
19893244 -beta1 shRNAs could obviously inhibit the expression levels of TGF-beta1, CTGF, FN and cellular proliferation stimulated by HSA in HK2 cells.
19890996 The synovial cells with treatment of 0.1 mg/mL Hylan decreased the CTGF gene expression.
19863391 Specifically, the CTGF mRNA and protein levels were 50% and 48% of the control levels, respectively. These findings suggest that cyclic stretching of fibroblasts contributes to anti-fibrotic processes by reducing CTGF production.
19861250 CTGF is an important mediator of high glucose-induced tubular epithelial hypertrophy, and transfection with siRNA targeting CTGF can alleviate hypertrophy.
19822645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19822645 The single nucleotide polymorphism (SNP) rs9402373 that lies close to CTGF is associated with severe hepatic fibrosis in two Chinese samples, in Sudanese, and in Brazilians infected with either Schistosoma japonicum or S. mansoni.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19764567 The expression of collagen III and CTGF in pPROM group were decreased significantly when compared to their control groups.
19764552 Rosiglitazone inhibits CTGF expression induced by TGF-beta1 in HLF-02 cells by activating PPARgamma through NF-kappaB and AP-1 signal transduction pathways.
19762080 The enhancement of CTGF expression as well as serum CTGF levels in clinical conditions attributed to placental dysfunction suggests a role for this secretory protein in the pathophysiology of placental injury or its sequelae.
19730442 results identify caspase-3 activation in endothelial cells as a novel inducer of CTGF release and fibrogenesis
19724859 CTGF and DUSP1 overexpression in residual breast cancer samples may be a reflection of resistance to further administration of doxorubicin/cyclophosphamide regimen
19673024 Data show that endogenous CCN2 is a mediator of basal or TGF-beta1-induced collagen I production in human HSCs and regulates entry of the cells into S phase.
19670427 Production of elevated CCN2 levels in hepatocytes of transgenic mice in vivo does not cause hepatic injury or fibrosis per se but renders the livers more susceptible to the injurious actions of other fibrotic stimuli.
19657322 Transforming growth factor-beta2 upregulates sphingosine kinase-1 activity, which in turn attenuates the fibrotic response to TGF-beta2 by impeding CTGF expression.
19641518 CTGF/CCN2 mediates collagen loss in chronologically aged human skin
19625611 For the first time in any system, fatty acid is newly identified as a regulator of CTGF, and this work implicates autocrine CTGF as a mediator of adverse effects of high glucose and fatty acids in cardiomyocytes.
19589256 This study was designed to investigate the effect of c-Jun N-terminal kinase (JNK) 1 and 2 on TGF-beta(1)-regulated CTGF gene expression and corneal scar formation.
19565505 A direct profibrotic effect of CTGF and its contribution to lung fibrosis through transcriptional activation of Col1a2 has been demonstrated.
19549692 hypoxia inhibits CTGF synthesis in human proximal tubular epithelial cells, involving HIF-1alpha.
19494553 Ras/MAP kinase pathway, specifically through N-Ras, mediates TGFbeta1 auto-induction and TGFbeta1-induced CTGF expression in human renal tubule epithelial cells.
19485899 [review] The TSP1/transforming growth factor beta/ connective tissue growth factor axis may contribute in the pro-inflammatory and pro-atherogenic state in patients affected with rheumatoid arthritis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429239 The results suggest that 15d-PGJ(2) inhibits TGF-beta-induced CTGF expression by inhibiting the phosphorylation of Smad2.
19409809 Increased urinary CCN2 is associated with the early progression of diabetic nephropathy, whereas MCP-1 is associated with later stage disease.
19382180 Downregulation of connective tissue growth factor by three-dimensional matrix enhances ovarian carcinoma cell invasion.
19378419 Signal transduction is involved in CTGF-induced production of chemokines in mesangial cells.
19333718 data demonstrated that preptin is involved in bone anabolism mediated by ERK/CTGF in human osteoblasts and may contribute to the preservation of bone mass observed in hyperinsulinemic states, such as obesity
19301259 Connective tissue growth factor enhances the migration of chondrosarcoma cells by increasing MMP-13 expression through the alphavbeta3 integrin, FAK, ERK, and NF-kappaB signal transduction pathway.
19298220 Results indicate that CCN2/CTGF binds to aggrecan through its N-terminal IGFBP and VWC modules, and this binding may be related to the CCN2/CTGF-enhanced production and secretion of aggrecan by chondrocytes.
19277979 Role of connective tissue growth factor and its interaction with basic fibroblast growth factor and macrophage chemoattractant protein-1 in skin fibrosis.
19253834 CTGF plays an important role in the pathogenesis of scleroderma and it is closely associated with the development of the pathologic fibrotic process.
19247157 strong CTGF expression in painful intervertebral discs may be related to disc fibrosis and degeneration
19243500 Observational study of gene-disease association. (HuGE Navigator)
19233176 A regulatory role for miR-18a in chondrocytic differentiation through CCN2.
19218111 High glucose treatment can increase CTGF mRNA and protein expressions in cultured human renal tubular epithelial cells.
19210343 plays an important role in wound healing and in the regeneration of periodontal tissue
19208517 HBx may facilitate liver fibrosis by promoting hepatic stellate cell proliferation and upregulating the expression of fibrosis-related molecules like CTGF
19179545 Increased CCN2 staining in clinical pancreatic tumor tissue relative to stromal cells surrounding the tumor, supporting our assertion that tumor cell-derived CCN2 is important for pancreatic tumor growth.
19153601 activation of GPR30 by OHT also induces CTGF in fibroblasts from breast tumour biopsies, these pathways may be involved in promoting aggressive behaviour of breast tumours in response to endogenous oestrogens or to OHT being used for endocrine therapy.
19096030 miR-133 and miR-30 regulate connective tissue growth factor: implications for a role of microRNAs in myocardial matrix remodeling.
19069651 CTGF and WISP-1 could play an important role in the progression of primary lung cancers by either individual gene itself or cointeraction.
19054818 The results confirm the association between an SNP in the CTGF gene and susceptibility to Systemic sclerosis, especially in the presence of diffuse cutaneous SSc, interstitial lung disease and anti-topoisomerase I antibody.
19054818 Observational study of gene-disease association. (HuGE Navigator)
19054816 results do not confirm previous findings and suggest that the CTGF -945 promoter polymorphism does not play a major role in SSc susceptibility or clinical phenotype.
19054816 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19016368 CTGF expression in human intervertebral disc: implications for angiogenesis in intervertebral disk degeneration are reported.
18936953 plasma membrane S1P(1) receptors are rapidly internalized and subsequently translocated to nuclear compartment upon S1P stimulation; nuclear S1P(1) is able to regulate the transcription of Cyr61 and CTGF
18922980 These data suggest that CTGF protein induced by S1P2 might act as a growth inhibitor in Wilms' tumor.
18922143 CCN2 expression occurred via activation of p38 mitogen-activated protein (MAP) kinase and the downstream transcription factor ATF-2.
18846327 High glucose-induced CTGF expression is mediated through the active SGK1 pathway in mesangial cells.
18836231 Findings suggest that CCN2 induced by mechanical stress may therefore play some role in meniscus growth and regeneration.
18835464 These results suggest that CCN2 regulates the expression of VEGF at a transcriptional level by promoting HIF-1alpha activity.
18805993 Regulation of CCN2/CTGF and related cytokines in cultured peritoneal cells under conditions simulating peritoneal dialysis.
18787533 AZX100, an analogue of the small heat shock protein, HSP20, reduces TGF-beta1-induced CTGF expression in keloid fibroblasts
18783549 CTGF is proposed as a fibrogenic master switch for epithelial-mesenchymal transition.
18683703 antisense oligonucleotides inhibit CTGF and fibronectin expression in human tenon' s capsule fibroblasts induced by transforming growth factor beta2.
18676875 Findings implicate the importance of CTGF in lung tissue repair and fibrosis and propose CTGF-induced migration of lung fibroblasts to the damaged tissue.
18648180 the up-regulation of CTGF expression may be responsible for the fibrosis process of urethral tissues in US patients
18639630 These results indicate a tight control of CTGF expression in pancreatic stellate cells at the transcriptional level.
18628999 CTGF is primarily a pro-fibrotic factor in the eye, and a shift in the balance between CTGF and VEGF is associated with the switch from angiogenesis to fibrosis in proliferative retinopathy
18622762 the influence of CTGF expression on the biological behavior and progression of various cancer cells, as well as its regulation on various types of protein signals and their mechanisms
18596209 Connective tissue growth factor inhibits adipocyte differentiation.
18481257 These results suggest that connective tissue growth factor (CTGF) plays an important role in the development of persistent skin fibrosis and that CTGF may be a potential and specific therapeutic target in skin fibrosis.
18451226 An unbiased analysis of the gallblader cancer transcriptome by serial analysis of gene expression has identified CTGF expression as a predictive biomarker of favorable prognosis in gallbladder cancer
18400984 Examine specific signals involved in the long-term maintenance of radiation-induced fibrogenic differentiation and suggest roles for CCN2 and TGF-beta1.
18395916 CTGF may have a role in lymph node metastases in gastric cancer
18358427 connective tissue growth factor/CCN2 has roles in tissue repair, scarring and fibrosis [review]
18344285 Plasma CTGF contributes significantly to prediction of end-stage renal disease and mortality in patients with type 1 diabetic nephropathy.
18319604 In human renal fibroblasts, serum/glucocorticoid regulated kinase1 (SGK1) and connective tissue growth factor (CTGF) protein expression were enhanced by angiotensin II
18292194 Hypoxia enhances the production of CTGF in primary term human trophoblasts
18287089 TGFbeta1 stimulates CCN2 expression in human gingival fibroblasts through a RhoA-independent, Rac1/Cdc42-dependent mechanism
18266973 TGF-beta-dependent CTGF/CCN2 expression in hepatocytes cultured under completely TGF-beta-free conditions was analysed.
18264937 TGF-beta1 and CTGF mRNAs are correlated with urinary protein level in IgA nephropathy.
18245529 Expression levels at diagnosis may represent a useful molecular tool to early identification of patients with different prognosis in osteosarcoma
18212329 Increased expression of this protein correlates with the loss of VHL protein expression in renal cell carcinoma.
18172013 Heterochromatin protein gamma coordinately regulates CCN2/CTGF by interacting with MMP3, which affects the development, tissue remodeling, and pathology of arthritic diseases through this CCN2/CTGF regulation thus is suggested.
18080105 REVIEW: chemistry,biosynthesis, function of CCN2, and its relation to fibrosis and cancer
17996907 In conclusion, TGF-beta1-CTGF pathway may play a role in the fibrosis that is commonly observed in muscular dystrophy.
17951996 ILK mediated the effect of epithelial to mesenchymal transition in proximal tubular epithelial cells stimulated by CTGF
17951630 the interaction of CTGF and beta-catenin-TCF/Lef forms a positive feedback loop, which could contribute to the tumorigenicity of ESCC.
17944991 CTGF mRNA expression was induced in HUVSMCs after treatment with dl-homocysteine (50 micromol L(-1)) for 1 h, which remained at the elevated level for up to 8 h.
17922682 CTGF is a useful prognostic marker for GC. High CTGF expression is associated with the risk of lymph nodes metastasis and a poor survival time in GC.
17915216 These data reveal a novel function for CTGF in the regulation of epithelial tissue repair beyond its established role in fibrosis, and further highlight the complexity of TGFbeta regulation of epithelial cell function.
17908800 MMP-2 processing of HARP and CTGF released vascular endothelial growth factor (VEGF) from angiogenic inhibitory complexes.
17881752 Observational study of gene-disease association. (HuGE Navigator)
17881752 The G-945C substitution represses CTGF transcription, and the -945G allele is significantly associated with susceptibility to systemic sclerosis.
17876891 Gastrointestinal carcinoid tumor fibrosis is a CTGF/TGFbeta1-mediated stellate cell-driven fibrotic response.
17786299 CTGF induction is associated with pancreatic cancer
17765657 Blocking experiments with the lysophosphatidic acid (LPA) receptor-specific inhibitor Ki16425 suggest a general involvement of LPA receptors in bacteria-triggered CTGF expression.
17681742 Basal expression of collagen, fibronectin and CCN2 and adhesion to matrix was not affected
17673559 Exercise with high mechanical loading induced the expression of CTGF in human skeletal muscle.
17671176 epigenetic silencing by hypermethylation of the CTGF promoter leads to a loss of CTGF function, which may be a factor in the carcinogenesis of ovarian cancer
17657819 Smad7 overexpression in cultured hepatocytes abrogated TGF-beta-dependent and intrinsic CTGF expression.
17622321 Overexpression of CTGF is one of the most important features of idiopathic portal hypertension.
17602195 CTGF is a functional target of aldosterone in mesangial cells, but aldosterone-induced CTGF gene expression is not directly mediated by the mineralocorticoid receptor.
17580150 Sirolimus conversion provided a beneficial strategy to improve long-term graft survival in chronic allograft nephropathy; attentuation of CTGF expression may be an antiproliferative effect.
17579708 Downregulation of the CTGF is associated with lung cancer.
17550972 Results suggest that CTGF plays a crucial role in migratory/invasive processes in human breast cancer by a mechanism involving activation of the integrin-alphavbeta3-ERK1/2-S100A4 pathway.
17498677 Connective tissue growth factor (CTFG) induces the expression of integrin-linked kinase (ILK) protein in HK-2 cells
17441427 The expression of CTGF and/or OPN might be important biological markers in reflecting the progression, biological behavior, metastatic potential and prognosis of laryngeal squamous cell carcinoma.
17437852 We found significant differences in gene expression, specifically with a group of genes, including CTGF, known to be responsive to estrogen or to interact with estrogen receptor.
17399955 The up-regulation of angiotensin II receptor type 1 and the consequent increase of CTGF expression, independently of TGFbeta1, participate in high-glucose-induced fibronectin production in cultured human dermal fibroblasts
17399683 We thus conclude that CCN2 enhances hBMSC attachment via integrin-p38 MAPK signal pathway.
17393107 Role of CTGF in extracellular matrix degradation in renal tubular epithelial cells is reported.
17375628 Observational study of gene-disease association. (HuGE Navigator)
17375628 CTGF polymorphism at -447 G/C was not associated with biliary atresia and jaundice in the postoperative period in Thai children
17239853 CCN2 supplies essential, non-redundant functions required for fibroblasts to properly participate in features of embryogenesis, and further suggest that CCN2 may play essential roles in adult wound healing, tissue repair and fibrogenesis.
17239539 CTGF contributes to the extracellular matrix accumulation in wound healing and tissue fibrosis by enhancing the affinity of FN to fibrin.
17224075 Expression of CTGF mRNA was up-regulated as early as 6 hours in cultured human vascular smooth muscle cells after exposed to high glucose condition, followed by extracellular matrix components accumulation.
17215322 In endothelial cells CTGF gene transcription is controlled by alteration is cytoskeletal actin and serum response factor.
17192487 Vitreous body cells may be a possible source of CTGF and thus might play a role in vitreoretinal interface diseases.
17170128 Connective tissue growth factor (CTGF) was the highest overexpressed gene in B-cell ALL compared with the other groups, and displayed heterogeneous expression, suggesting it might have prognostic relevance.
17119035 local factors, such as CTGF and genomic amplification, seem to be more important than germ line genetic variation in influencing PAI1 expression and its untoward effects in breast cancer
17116388 IFN-gamma interferes with stellate cell activation in the pancreas and suggest activated STAT1 as an inductor of a quiescent pancreatic stellate cells phenotype.
17093396 CTGF in trabecular meshwork is modulated by physiological agonists and by increased ocular pressure and mechanical stretch. Regulation of CTGF within outflow pathway may play role in homeostasis of intraocular pressure.
16899928 this study demonstrated that CTGF is released from platelets by high shear stress; furthermore, disturbed flow along atherosclerotic vessels may induce endothelial CTGF expression and contribute to the progress of atherosclerotic lesions
16889607 CTGF has potential as a biomarker of CAN, and also a therapeutic target in managing graft fibrosis.
16877704 CTGF may behave as a secreted tumor suppressor protein in the normal lung, and its expression is suppressed in many NSCLCs.
16858645 Observational study of gene-disease association. (HuGE Navigator)
16820572 A delicate balance of collagen, elastin, & vascular smooth muscle cells in the aortic wall is clearly essential for a compliant aorta, and CTGF may play a vital role in this balance.
16813525 CCN2 was critically involved in osteolytic metastasis and was induced by PKA- and PKC-dependent activation of ERK1/2 signaling by PTHrP.
16790529 CTGF stimulated the phosphorylation and cytoplasmic translocation of p27(Kip-1) on serine 10; role of p27(Kip-1) as a mediator of actin rearrangement.
16731742 These findings suggest that CTGF may contribute to aberrant autocrine and paracrine pathways that promote pancreatic cancer cell growth, invasion, metastasis, and angiogenesis
16684954 Bradykinin and angiotensin II lower CTGF mRNA expression below basal levels over a span of 4 hours.
16543635 Migration of HUVECs transfected with CTGF vector increased significantly compared with those transfected with vector control
16528248 Tranilast is a potential effective antifibrotic compound in the kidney, exerting its effects via inhibition of TGF-beta1-induced CTGF expression and downstream activation of the Smad2 pathway in both PTCs and CFs.
16501850 Observational study of gene-disease association. (HuGE Navigator)
16501850 The CTGF gene was resequenced to identify novel or known variants, and make an analysis of their association with diabetic nephropathy.
16482098 Administration of losartan, but not amlodipine, to hypertensive patients improves structural abnormalities and prevents the production of CTGF and TGF-beta in small arteries.
16457822 CCN2/CTGF enhances chondrocyte adhesion to FN through direct interaction of its C-terminal CT domain with FN, and alpha5beta1 is involved in this adhesion.
16373901 Urinary CTGF may be a progression promoter in diabetic nephropathy.
16291159 In biliary atresia livers, novel biliary epithelia CTGF mRNA expression is high and correlates with severity of fibrosis; these data support a role for biliary epithelial cell signaling in fibrogenesis
16270194 increased glomerular expression of CTGF occurs from the earliest stage of diabetic nephropathy; CTGF is required for mesangial synthesis of fibronectin stimulated by high glucose or glycated albumin
16255854 CTGF may play a role in the pathogenetic process of muscular dystrophy, and may be important for muscle repair and fibrosis.
16247469 Hypoxia increased the ctgf/ccn2 mRNA level by altering the 3'-untranslated region (UTR)-mediated mRNA stability without requiring de novo protein synthesis.
16204411 CTGF plays a specific role as a downstream mediator of TGF-beta(1)-induced renal fibrosis
16186174 CTGF expression in the brain might have a role in Alzheimer's disease clinical progression and neuropathology
16044512 Cis-acting element of structure-anchored repression of CTGF was investigated.
15956925 Human CTGF is a cysteine rich polypeptide that has similar structures to PDGF and has been implicated in connective tissue formation. PDGF and CTGF may play a role in the development of aneurysmal walls in both AAAA and IAAA.
15950619 Under pathological conditions, where CTGF expression is elevated, CTGF blocks the negative feedback loop provided by Smad 7, allowing continued activation of the TGFbeta signaling pathway.
15941869 Negative regulation of CTGF by hCG during luteal rescue mediated by paracrine signals.
15940639 CTGF induction is important for robust oval cell response during liver regeneration after 2-AAF/partial hepatectomy treatment in rats
15857887 data provide a molecular basis for the divergence of connective tissue growth factor (CTGF) actions on connective tissue cell types
15820145 indicate novel roles of M-CSF in articular cartilage metabolism in collaboration with CTGF/CCN2, particularly during an inflammatory response
15761249 CTGF upregulation in arterial vascular smooth muscle cells of the lung is associated with the pathogenesis of pulmonary hypertension.
15761189 CTGF protein is significantly increased in complicated compared with fibrous plaques and may enhance monocyte migration into atherosclerotic lesions, thus contributing to atherogenesis.
15703175 sodium-hydrogen exchanger activity modulates connective tissue growth factor mRNA expression in transforming growth factor beta1- and Des-Arg10-kallidin-stimulated myofibroblasts
15598883 CCN2 is one of the major functional components of platelets
15536170 key dependence of the fibrogenic actions of CTGF on TGF-beta in kidney
15526358 Cyr61 and CTGF genes may play an important role in hepatocellular carcinogenesis and correlate with recurrence and metastasis of hepatocellular carcinoma.
15459777 CTGF plays a major role in the pathogenesis of progressive fibrosis in biliary atresia.
15377500 TGF-beta 1-stimulated CTGF expression is mediated by mechanisms involving ERK and JNK pathways and is downregulated by IL-4 and IL-13 through modulation of Smad and ERK signals.
15345671 CTGF has a role in the reduced matrix degradation observed in diabetic nephropathy.
15298857 Simvastatin through a Rho signaling mechanism in lung fibroblasts can modulate CTGF expression and interaction with TGF-beta.
15247510 CTGF has a role in scleroderma and in pathological fibrosis [review]
15135656 CTGF may play a crucial role in the renal tubular epithelial-transdifferentiation and the following deposition/degradation process of extracellular matrix during tubulointerstitial fibrosis
15113833 Generated antibodies for functional analysis of CTGF. Showed antibody bound to the CT module neutralizes efficiently the stimulatory effect of CTGF on chondrocytic cell proliferation
15111539 Levels are elevated in type 1 diabetic patients with nephropathy and appear to be correlated with proteinuria and creatinine clearance.
15090860 connective tissue growth factor seems to be an attractive alternative therapeutic target for combating renal fibrosis--REVIEW
15053922 evidence that adenylate cyclase as well as one or several protein kinases might be involved in the mechanoregulation of Cyr61, CTGF and Nov genes
15045137 unstimulated platelets contain considerable amounts of CTGF; CTGF presence in platelets is a result of endocytosis from extracellular environment in bone marrow; agonist-stimulation of platelets resulted in release of CTGF from the storage granules
15041728 CYR61 and CTGF may play a role in the progression of gliomas; their levels at diagnosis may have prognostic significance.
15039132 Observational study of gene-disease association. (HuGE Navigator)
15003992 Fibroblast proliferation, differentiation into myofibroblasts, & increased collagen synthesis are regulated via a CTGF-dependent pathway. CTGF serves to control a pivotal switch point in the cascade for connective tissue formation.
14996858 CTGF inhibits metastasis and invasion of human lung adenocarcinoma by a CRMP-1-dependent mechanism.
14988298 The NH2-terminal CTGF fragment content is increased in the vitreous of patients with proliferative diabetic retinopathy.
14758550 results suggest that connective tissue growth factor(CTGF) is involved in extracellular matrix production in parietal epithelial cells and that it is one of the mediators promoting the scarring process in glomerular crescents
14684735 the sequence IRTPKISKPIKFELSG within CCN2is a unique binding domain for integrin alpha(v)beta(3) that is sufficient to mediate hepatic stellate cell adhesion
14633859 Cooperation between CTGF and IGF-I might be involved in glucose-induced matrix accumulation in tubulointerstitial fibrosis and might contribute to pathogenesis of diabetic nephropathy.
14512169 Postmortem brain tissue analysis demonstrates CTGF localized occasionally in astrocytes but not in macrophages/microglial cells of patients with cerebral malaria.
12951326 data link alterations in the microtubule and actin cytoskeleton to the expression of connective tissue growth factor
12941731 Magnitude of Urinary CTGF NH(2)-terminal fragment excretion is related to the severity of diabetic nephropathy
12888575 the constitutive overexpression of CTGF in SSc fibroblasts seems to be independent of TGFbeta signaling but dependent at least in part on Sp1
12831056 Regulates angiogenesis and endothelial cell function. (review)
12811819 CTGF/Hcs24 produced in the hypertrophic region may act on chondrocytes in the proliferative and maturative zone via some heparan sulfate proteoglycan, such as perlecan.
12787426 Production of CTGF by peritoneal mesothelial cells and its presence in peritoneal cavity in peritoneal dialysis. Increase in CTGF in peritoneal membrane fibrosis suggests involvement in underlying pathophysiologic mechanism(s).
12760970 These results suggest that TGF-beta1-induced CTGF mRNA expression is mediated through the JNK-dependent pathway, whereas p38 MAP kinase and ERK pathways minimally contribute
12668285 CTGF acts as a negative regulator of the cell growth in oral squamous cell carcinoma possibly through its interaction with growth modifiers inside the cell
12595495 Alterations in alpha5beta1 levels induced by TGF-beta are mediated at least in part through the induction of CTGF in glomerular mesangium
12571253 Gene expression regulation requires tgf-beta2 in fibroblasts.
12535930 In brains from Alzheimer's patients, a strong tangle-associated CTGF immunoreactivity was observed in entorhinal cortex, hippocampus and temporal cortex.
12496395 In contrast to CD4+ alpha beta-T cells, gamma delta-T cells are capable of expressing CTGF mRNA and synthesizing its corresponding protein, which supports the concept that gamma delta-T cells contribute to wound healing or tissue fibrotic processes.
12470643 CTGF interacts with the cytoskeletal protein actin in chondrocytes.
12398938 localization and expression during fracture healing
12239232 CTGF is a hypertrophic factor for human mesangial cells. molecular mechanisms underlying this G(1) phase arrest appear to be due to the induction of the cyclin-dependent kinase inhibitors (CDKI) p15(INK4), p21(Cip1), and p27(Kip1).
12218048 CTGF mediates a number of its biological effects by the induction of signaling processes via beta(3) integrin
12217862 role in epithelial-mesenchymal transdifferentiation
12150969 enhancement of expression on chondrocytes by a novel cis-element
12114504 CTGF has a role in binding to MMPs and VEGF-induced physiological or pathologic angiogenesis
12036876 Identification of integrin alpha(M)beta(2) as an adhesion receptor on human peripheral blood monocytes for Cyr61 and connective tissue growth factor: immediate-early gene products expressed in atherosclerotic lesions.
12016149 role in initiating angiogenesis in collaboration with matrix metalloproteinases
11967989 IL-4 interfered with the TGF-beta-induced transcriptional activation of the CTGF gene.
11897682 the induction of FN by AGE is partly mediated by the AGE-induced up-regulation of cell-derived CTGF and is dependent on PKC activity
11855859 Mechanical stress is required for high-level expression of connective tissue growth factor in fibroblasts.
11818516 gene is expressed in granulosa-luteal cells (insulin-like growth factor binding protein-related protein-2; IGFBP-rP2)
11751417 Elevated levels of connective tissue growth factor, WISP-1, and CYR61 in primary breast cancers associated with more advanced features.

AA Sequence

MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTE      1 - 70
RDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMD     71 - 140
VRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACS    141 - 210
KTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYR    211 - 280
AKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA     281 - 349
//

Text Mined References (434)

PMID Year Title
26909983 2016 Expression of transforming growth factor-?1 and connective tissue growth factor in congenital biliary atresia and neonatal hepatitis liver tissue.
26719893 2015 The Overexpression of TGF-? and CCN2 in Intrauterine Adhesions Involves the NF-?B Signaling Pathway.
26707502 2016 Downregulation of connective tissue growth factor reduces migration and invasiveness of osteosarcoma cells.
26577677 2016 Growth differentiation factor 8 suppresses cell proliferation by up-regulating CTGF expression in human granulosa cells.
26575166 2015 Connective tissue growth factor as a novel therapeutic target in high grade serous ovarian cancer.
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26421309 2015 Potential Renoprotective Agents through Inhibiting CTGF/CCN2 in Diabetic Nephropathy.
26318291 2015 Epithelial derived CTGF promotes breast tumor progression via inducing EMT and collagen I fibers deposition.
26218313 2015 CCN2 and CCN5 exerts opposing effect on fibroblast proliferation and transdifferentiation induced by TGF-?.
26192087 2015 Rapamycin increases CCN2 expression of lung fibroblasts via phosphoinositide 3-kinase.
26171399 2015 Elevated Urinary Connective Tissue Growth Factor in Diabetic Nephropathy Is Caused by Local Production and Tubular Dysfunction.
26138615 2015 Novel CT domain-encoding splice forms of CTGF/CCN2 are expressed in B-lineage acute lymphoblastic leukaemia.
25955392 2015 TGF-?1 Up-Regulates Connective Tissue Growth Factor Expression in Human Granulosa Cells through Smad and ERK1/2 Signaling Pathways.
25940705 2015 Transcriptional co-activator TAZ sustains proliferation and tumorigenicity of neuroblastoma by targeting CTGF and PDGF-?.
25916872 2015 Connective tissue growth factor and the cicatrization of cellular crescents in ANCA-associated glomerulonephritis.
25899830 2015 Myeloid Zinc Finger 1 (MZF-1) Regulates Expression of the CCN2/CTGF and CCN3/NOV Genes in the Hematopoietic Compartment.
25847507 2015 The association of single nucleotide polymorphisms in the connective tissue growth factor gene with pseudoexfoliation syndrome/glaucoma.
25847009 2015 Tumoural Expression of Connective Tissue Growth Factor (CTGF) Impacts on Survival in Patients Diagnosed with Hepatocellular Carcinoma (HCC).
25779637 2015 Inflammatory microenvironment and tumor necrosis factor alpha as modulators of periostin and CCN2 expression in human non-healing skin wounds and dermal fibroblasts.
25761878 2015 MicroRNA-26b inhibits metastasis of osteosarcoma via targeting CTGF and Smad1.
25738829 2015 Expression of connective tissue growth factor in male breast cancer: clinicopathologic correlations and prognostic value.
25727552 2015 The effect of 595?nm pulsed dye laser on connective tissue growth factor (CTGF) expression in cultured keloid fibroblasts.
25727481 2015 SMAD3 and SP1/SP3 Transcription Factors Collaborate to Regulate Connective Tissue Growth Factor Gene Expression in Myoblasts in Response to Transforming Growth Factor ?.
25704370 2015 The regulation of connective tissue growth factor expression influences the viability of human trabecular meshwork cells.
25647524 2015 GPER in CAFs regulates hypoxia-driven breast cancer invasion in a CTGF-dependent manner.
25601519 2015 Transforming growth factor ?2 (TGF-?2)-induced connective tissue growth factor (CTGF) expression requires sphingosine 1-phosphate receptor 5 (S1P5) in human mesangial cells.
25502877 2015 Investigating the association between polymorphisms in connective tissue growth factor and susceptibility to colon carcinoma.
25501363 2015 MicroRNA?133b inhibits connective tissue growth factor in colorectal cancer and correlates with the clinical stage of the disease.
25495560 2014 Autophagy fosters myofibroblast differentiation through MTORC2 activation and downstream upregulation of CTGF.
25478966 2014 Anti-CTGF single-chain variable fragment dimers inhibit human airway smooth muscle (ASM) cell proliferation by down-regulating p-Akt and p-mTOR levels.
25384022 2014 Patients with encapsulating peritoneal sclerosis have increased peritoneal expression of connective tissue growth factor (CCN2), transforming growth factor-?1, and vascular endothelial growth factor.
25349161 2015 A promoter polymorphism -945C>G in the connective tissue growth factor in heart failure patients with mechanical circulatory support: a new marker for bridge to recovery?
25341039 2014 CTGF increases vascular endothelial growth factor-dependent angiogenesis in human synovial fibroblasts by increasing miR-210 expression.
25261584 2015 CCN family protein 2 (CCN2) promotes the early differentiation, but inhibits the terminal differentiation of skeletal myoblasts.
25203810 2015 Connective tissue growth factor and integrin ?v?6: a new pair of regulators critical for ductular reaction and biliary fibrosis in mice.
25150958 2014 Connective tissue growth factor induces tube formation and IL-8 production in first trimester human placental trophoblast cells.
25126747 2014 Increased expression of CCN2, epithelial membrane antigen, and fibroblast activation protein in hepatocellular carcinoma with fibrous stroma showing aggressive behavior.
25121739 2014 CXCL12 induces connective tissue growth factor expression in human lung fibroblasts through the Rac1/ERK, JNK, and AP-1 pathways.
25111595 2015 Expression of heat shock protein 47, transforming growth factor-beta 1, and connective tissue growth factor in liver tissue of patients with Schistosoma japonicum-induced hepatic fibrosis.
25030555 2014 Association between gene polymorphisms of connective tissue growth factor and the progression of chronic liver disease associated with hepatitis C.
25003330 2014 CTGF increases matrix metalloproteinases expression and subsequently promotes tumor metastasis in human osteosarcoma through down-regulating miR-519d.
24985492 2015 Connective tissue growth factor inhibits gastric cancer peritoneal metastasis by blocking integrin ?3?1-dependent adhesion.
24973271 2014 Plasma connective tissue growth factor levels as potential biomarkers of airway obstruction in patients with asthma.
24933320 2014 Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S100A9.
24882759 2014 Exosomes mediate intercellular transfer of pro-fibrogenic connective tissue growth factor (CCN2) between hepatic stellate cells, the principal fibrotic cells in the liver.
24828686 2014 Caffeine and rolipram affect Smad signalling and TGF-?1 stimulated CTGF and transgelin expression in lung epithelial cells.
24758915 2014 Ceramide inhibits connective tissue growth factor expression by human retinal pigment epithelial cells.
24755068 2014 TGF-?2 induces transdifferentiation and fibrosis in human lens epithelial cells via regulating gremlin and CTGF.
24703458 2014 Construction of a CTGF and RFP-coexpressed renal tubular epithelial cell and its application on evaluation of CTGF-specific siRNAs on epithelial-mesenchymal transition.
24700237 2014 Expression and clinical significance of connective tissue growth factor in advanced head and neck squamous cell cancer.
24689870 2014 Toll-like receptor 6 and connective tissue growth factor are significantly upregulated in mitomycin-C-treated urothelial carcinoma cells under hydrostatic pressure stimulation.
24676352 2014 Correlation of CTGF gene promoter methylation with CTGF expression in type 2 diabetes mellitus with or without nephropathy.
24597264 2013 The expression of glutathione peroxidase-1 and the anabolism of collagen regulation pathway transforming growth factor-beta1-connective tissue growth factor in women with uterine prolapse and the clinic significance.
24577260 2013 Analysis of relative expression level of VEGF ( vascular endothelial growth factor ), HIF-1? ( hypoxia inducible factor 1? ) and CTGF ( connective tissue growth factor ) genes in chronic glomerulonephritis (CGN) patients.
24560449 2014 Cyclosporine A induces connective tissue growth factor expression in human gingival fibroblasts: suppression by epigallocatechin-3-gallate.
24503185 2014 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24485923 2014 Elevated YAP and its downstream targets CCN1 and CCN2 in basal cell carcinoma: impact on keratinocyte proliferation and stromal cell activation.
24464932 2014 Connective tissue growth factor and cardiac diastolic dysfunction: human data from the Taiwan diastolic heart failure registry and molecular basis by cellular and animal models.
24464580 2014 CCN2 suppresses catabolic effects of interleukin-1? through ?5?1 and ?V?3 integrins in nucleus pulposus cells: implications in intervertebral disc degeneration.
24462773 2014 CTGF increases drug resistance to paclitaxel by upregulating survivin expression in human osteosarcoma cells.
24413988 2014 BMP9 inhibits the bone metastasis of breast cancer cells by downregulating CCN2 (connective tissue growth factor, CTGF) expression.
24269276 2014 The regenerative effects of CCN2 independent modules on chondrocytes in vitro and osteoarthritis models in vivo.
24154679 2014 Targeting connective tissue growth factor (CTGF) in acute lymphoblastic leukemia preclinical models: anti-CTGF monoclonal antibody attenuates leukemia growth.
24146089 2014 Connective tissue growth factor (CTGF/CCN2): diagnostic and prognostic value in acute heart failure.
24122827 2014 Epigenetic regulation of connective tissue growth factor by MicroRNA-214 delivery in exosomes from mouse or human hepatic stellate cells.
24121259 2013 The influence of CTGF single-nucleotide polymorphisms on outcomes in Crohn's disease.
24112732 2013 Regulation of CCN2 gene expression and possible roles in developing tooth germs.
24090133 2013 Tumour cells down-regulate CCN2 gene expression in co-cultured fibroblasts in a Smad7- and ERK-dependent manner.
24079812 2013 CCN2 is transiently expressed by keratinocytes during re-epithelialization and regulates keratinocyte migration in vitro by the ras-MEK-ERK signaling pathway.
24074434 2014 Functional characteristics of connective tissue growth factor on human tenon's capsule fibroblast.
24035571 2015 Sphingosine-1-phosphate stimulated connective tissue growth factor expression in human buccal fibroblasts: Inhibition by epigallocatechin-3-gallate.
24014274 2014 Transforming growth factor-? (TGF-?) expression is increased in the subsynovial connective tissues of patients with idiopathic carpal tunnel syndrome.
24005672 2013 Transforming growth factor-? (TGF-?)-mediated connective tissue growth factor (CTGF) expression in hepatic stellate cells requires Stat3 signaling activation.
23988606 2013 CCN2 promotes keratinocyte adhesion and migration via integrin ?5?1.
23847295 2013 Expression and clinical significance of connective tissue growth factor in thyroid carcinomas.
23824844 2013 Requirement for active glycogen synthase kinase-3? in TGF-?1 upregulation of connective tissue growth factor (CCN2/CTGF) levels in human gingival fibroblasts.
23772794 2013 Hypomethylation of the CTGF gene locus is a common feature of paediatric pre-B acute lymphoblastic leukaemia.
23755163 2014 Reduced CTGF expression promotes cell growth, migration, and invasion in nasopharyngeal carcinoma.
23741006 2013 Connective tissue growth factor regulates adipocyte differentiation of mesenchymal stromal cells and facilitates leukemia bone marrow engraftment.
23727026 2013 Transforming growth factor ? induces expression of connective tissue growth factor in hepatic progenitor cells through Smad independent signaling.
23687336 2013 Connective tissue growth factor activates pluripotency genes and mesenchymal-epithelial transition in head and neck cancer cells.
23681229 2013 Loss of connective tissue growth factor as an unfavorable prognosis factor activates miR-18b by PI3K/AKT/C-Jun and C-Myc and promotes cell growth in nasopharyngeal carcinoma.
23663495 2013 Adenosine A(2A) receptors promote collagen production by a Fli1- and CTGF-mediated mechanism.
23648563 2013 The C-terminal module IV of connective tissue growth factor is a novel immune modulator of the Th17 response.
23631855 2013 Tensile strain increases expression of CCN2 and COL2A1 by activating TGF-?-Smad2/3 pathway in chondrocytic cells.
23593935 2013 Inhibition of connective tissue growth factor (CTGF/CCN2) in gallbladder cancer cells leads to decreased growth in vitro.
23582094 2013 Regulation of connective tissue growth factor gene expression and fibrosis in human heart failure.
23567513 2013 Molecular regulation of CCN2 in the intervertebral disc: lessons learned from other connective tissues.
23564449 2013 Heterogeneous nuclear ribonucleoprotein K (hnRNP-K) promotes tumor metastasis by induction of genes involved in extracellular matrix, cell movement, and angiogenesis.
23530034 2013 Hypoxia-inducible factor (HIF)-1? and CCN2 form a regulatory circuit in hypoxic nucleus pulposus cells: CCN2 suppresses HIF-1? level and transcriptional activity.
23508392 2014 Elevated expression of connective tissue growth factor, osteopontin and increased collagen content in human ascending thoracic aortic aneurysms.
23501329 2013 Connective tissue growth factor (CTGF/CCN2) in serum is an indicator of fibrogenic progression and malignant transformation in patients with chronic hepatitis B infection.
23494140 2013 The role of ERK and JNK signaling in connective tissue growth factor induced extracellular matrix protein production and scar formation.
23454256 2013 Interleukin-1 has opposing effects on connective tissue growth factor and tenascin-C expression in human cardiac fibroblasts.
23435419 2014 CTGF is a therapeutic target for metastatic melanoma.
23414795 2013 Genetic analysis of human predisposition to hepatosplenic disease caused by schistosomes reveals the crucial role of connective tissue growth factor in rapid progression to severe hepatic fibrosis.
23390502 2013 MicroRNA-145 is downregulated in glial tumors and regulates glioma cell migration by targeting connective tissue growth factor.
23383241 2013 Connective tissue growth factor (CTGF/CCN2) is negatively regulated during neuron-glioblastoma interaction.
23368866 2013 Connective tissue growth factor immunohistochemical expression is associated with gallbladder cancer progression.
23323010 2012 Connective tissue growth factor is overexpressed in human hepatocellular carcinoma and promotes cell invasion and growth.
23307318 2013 Enhanced production of CTGF and IL-11 from highly metastatic hepatoma cells under hypoxic conditions: an implication of hepatocellular carcinoma metastasis to bone.
23284892 2012 Myocardial connective tissue growth factor (CCN2/CTGF) attenuates left ventricular remodeling after myocardial infarction.
23280549 2013 Growth differentiation factor-15 (GDF-15) suppresses in vitro angiogenesis through a novel interaction with connective tissue growth factor (CCN2).
23274856 2013 CTGF induces monocyte chemoattractant protein-1 expression to enhance monocyte migration in human synovial fibroblasts.
23227240 2012 CTGF increases IL-6 expression in human synovial fibroblasts through integrin-dependent signaling pathway.
23175185 2013 CCN2 inhibits lung cancer metastasis through promoting DAPK-dependent anoikis and inducing EGFR degradation.
23142580 2012 CCN2/CTGF binds to fibroblast growth factor receptor 2 and modulates its signaling.
23108098 2013 Thrombin-induced CCN2 expression in human lung fibroblasts requires the c-Src/JAK2/STAT3 pathway.
23073116 2013 Connective tissue growth factor is a positive regulator of epithelial-mesenchymal transition and promotes the adhesion with gastric cancer cells in human peritoneal mesothelial cells.
23061738 2012 Urinary mRNA expression of CCN2/CCN3 as a noninvasive marker for monitoring glomerular structure changes in nondiabetic chronic kidney disease.
23056332 2012 Activation of the connective tissue growth factor (CTGF)-transforming growth factor ? 1 (TGF-? 1) axis in hepatitis C virus-expressing hepatocytes.
23055574 2012 Osteopontin and other regulators of angiogenesis and fibrogenesis in the vitreous from patients with proliferative vitreoretinal disorders.
23044205 2012 [Angiotensin (1-7) inhibits angiotensin II-stimulated expression of connective tissue growth factor mRNA in hepatic stellate cells].
23029004 2012 IFN-? and TNF-? synergize to inhibit CTGF expression in human lung endothelial cells.
22964303 2012 Gravity-sensitive signaling drives 3-dimensional formation of multicellular thyroid cancer spheroids.
22918238 2012 Convergent signaling in the regulation of connective tissue growth factor in malignant mesothelioma: TGF? signaling and defects in the Hippo signaling cascade.
22906474 2012 Association between the CTGF -945C/G polymorphism and systemic sclerosis: a meta-analysis.
22846210 2012 Concentrations of connective tissue growth factor in patients with nonalcoholic fatty liver disease: association with liver fibrosis.
22814105 2012 Oncostatin M inhibits TGF-?1-induced CTGF expression via STAT3 in human proximal tubular cells.
22795353 2013 Hypoxia enhances the interaction between pancreatic stellate cells and cancer cells via increased secretion of connective tissue growth factor.
22699679 2012 Genistein attenuates advanced glycation end product-induced expression of fibronectin and connective tissue growth factor.
22684333 2012 CTGF drives autophagy, glycolysis and senescence in cancer-associated fibroblasts via HIF1 activation, metabolically promoting tumor growth.
22611323 2012 Clinical significance of connective tissue growth factor in hepatitis B virus-induced hepatic fibrosis.
22586581 2012 Hyperglycemia causes renal cell damage via CCN2-induced activation of the TrkA receptor: implications for diabetic nephropathy.
22576977 2012 Mechanical stretch increases Smad3-dependent CCN2 expression in inner meniscus cells.
22539964 2012 Ets-1 is essential for connective tissue growth factor (CTGF/CCN2) induction by TGF-?1 in osteoblasts.
22533709 2012 The CTGF gene -945?G/C polymorphism is not associated with cardiac or kidney complications in subjects with type 2 diabetes.
22532143 2012 Atrial expression of the CCN1 and CCN2 proteins in chronic heart failure.
22516997 2012 [Expression of transforming growth factor beta 1 and conection tissue growth factor in ankylosing spondylitis].
22466886 2012 Role of CTGF/CCN2 in reparative dentinogenesis in human dental pulp.
22454511 2012 Role of LRP1 in transport of CCN2 protein in chondrocytes.
22438586 2012 Antiproliferative factor regulates connective tissue growth factor (CTGF/CCN2) expression in T24 bladder carcinoma cells.
22422617 2012 Low-density lipoprotein induced expression of connective tissue growth factor via transactivation of sphingosine 1-phosphate receptors in mesangial cells.
22416876 2012 Plasma and synovial fluid connective tissue growth factor levels are correlated with disease severity in patients with knee osteoarthritis.
22395513 2012 The involvement of TGF-?1 and CTGF in regional gingival overgrowth.
22363806 2012 Activation of JNK signaling mediates connective tissue growth factor expression and scar formation in corneal wound healing.
22350758 2012 Neuregulin induces CTGF expression in hypertrophic scarring fibroblasts.
22340243 2011 Inhibition of connective tissue growth factor overexpression decreases growth of hepatocellular carcinoma cells in vitro and in vivo.
22335903 2011 [Role of connective tissue growth factor (CTGF) in proliferation and migration of pancreatic cancer cells].
22328559 2012 The presence and regulation of connective tissue growth factor in the human endometrium.
22205539 2012 Expression of connective tissue growth factor and interleukin-11 in intratumoral tissue is associated with poor survival after curative resection of hepatocellular carcinoma.
22134873 2012 MMP-3 provokes CTGF/CCN2 production independently of protease activity and dependently on dynamin-related endocytosis, which contributes to human dental pulp cell migration.
22099397 BMP-7/TGF-?1 signalling in myoblasts: components involved in signalling and BMP-7-dependent blockage of TGF-?-mediated CTGF expression.
22045431 2011 A polymorphism within the connective tissue growth factor (CTGF) gene has no effect on non-invasive markers of beta-cell area and risk of type 2 diabetes.
21955589 2011 Downregulation of connective tissue growth factor inhibits the growth and invasion of gastric cancer cells and attenuates peritoneal dissemination.
21946149 2011 Adiponectin reduces connective tissue growth factor in human hepatocytes which is already induced in non-fibrotic non-alcoholic steatohepatitis.
21928342 2012 The Wnt antagonist Wif-1 interacts with CTGF and inhibits CTGF activity.
21927029 2012 Connective tissue growth factor modulates oral squamous cell carcinoma invasion by activating a miR-504/FOXP1 signalling.
21907704 2011 Extracellular acidification induces connective tissue growth factor production through proton-sensing receptor OGR1 in human airway smooth muscle cells.
21864521 2011 Plasma CCN2 (connective tissue growth factor; CTGF) is a potential biomarker in idiopathic pulmonary fibrosis (IPF).
21800344 2011 Connective tissue growth factor autocriny in human hepatocellular carcinoma: oncogenic role and regulation by epidermal growth factor receptor/yes-associated protein-mediated activation.
21784839 2011 Effects of antiproteinuric intervention on elevated connective tissue growth factor (CTGF/CCN-2) plasma and urine levels in nondiabetic nephropathy.
21771732 2011 Effect of brain- and tumor-derived connective tissue growth factor on glioma invasion.
21760921 2011 CCN2 is required for the TGF-? induced activation of Smad1-Erk1/2 signaling network.
21747166 2011 Increases in p53 expression induce CTGF synthesis by mouse and human hepatocytes and result in liver fibrosis in mice.
21673687 2011 CTGF is overexpressed in malignant melanoma and promotes cell invasion and migration.
21659659 2011 Connective tissue growth factor antibody therapy attenuates hyperoxia-induced lung injury in neonatal rats.
21654839 2011 Loss of PTEN expression by dermal fibroblasts causes skin fibrosis.
21629692 2011 Suppression of estrogen receptor transcriptional activity by connective tissue growth factor.
21611193 2011 Mechanical tension increases CCN2/CTGF expression and proliferation in gingival fibroblasts via a TGF?-dependent mechanism.
21609598 2011 [Production of connective tissue growth factor by angiotensin II in human embryonic lung fibroblast via RhoA-ROCK pathway].
21609573 2011 [Expression of connective tissue growth factor and pathological remodeling in ascending thoracic aortic aneurysm].
21576830 2011 Elevated expression of connective tissue growth factor in human atrial fibrillation and angiotensin II-treated cardiomyocytes.
21569762 2011 Mechanical stretch increases CCN2/CTGF expression in anterior cruciate ligament-derived cells.
21558398 2011 Connective tissue growth factor acts as a therapeutic agent and predictor for peritoneal carcinomatosis of colorectal cancer.
21548990 2011 The CTGF -945GC polymorphism is not associated with plasma CTGF and does not predict nephropathy or outcome in type 1 diabetes.
21503841 2011 CTGF is overexpressed in papillary thyroid carcinoma and promotes the growth of papillary thyroid cancer cells.
21501375 2011 MicroRNA-18 and microRNA-19 regulate CTGF and TSP-1 expression in age-related heart failure.
21484860 2011 Hypertrophy of ligamentum flavum in lumbar spine stenosis associated with the increased expression of connective tissue growth factor.
21455569 2011 Expression of connective tissue growth factor (CTGF/CCN2) in breast cancer cells is associated with increased migration and angiogenesis.
21424084 2011 Evidence for the involvement of TGF-?1-CTGF axis in liver fibrogenesis secondary to hepatic viral infection.
21352962 2011 CTGF inhibits cell motility and COX-2 expression in oral cancer cells.
21349946 2011 Taxol resistance in breast cancer cells is mediated by the hippo pathway component TAZ and its downstream transcriptional targets Cyr61 and CTGF.
21265091 2010 [The effect of hypoxia on the expression of RHO/RHO signaling pathway and CTGF of human embryonic fibroblasts].
21245987 2011 Connective tissue growth factor reacts as an IL-6/STAT3-regulated hepatic negative acute phase protein.
21245951 2011 Gene expression profiling of connective tissue growth factor (CTGF) stimulated primary human tenon fibroblasts reveals an inflammatory and wound healing response in vitro.
21236242 2011 Binding of glyceraldehyde-3-phosphate dehydrogenase to the cis-acting element of structure-anchored repression in ccn2 mRNA.
21209863 2010 Recombinant expression, purification, and functional characterisation of connective tissue growth factor and nephroblastoma-overexpressed protein.
21166920 2011 Connective tissue growth factor (CTGF/CCN2) mediates angiogenic effect of S1P in human dermal microvascular endothelial cells.
21098624 2011 CTGF expression is up-regulated by PROK1 in early pregnancy and influences HTR-8/Svneo cell adhesion and network formation.
21081514 2011 Expression of CTGF and Cyr61 in colorectal cancer.
21071938 2010 CCN2 (CTGF) gene polymorphism is a novel prognostic risk factor for cardiovascular outcomes in hemodialysis patients.
21054221 2011 Smad7 blocks transforming growth factor-?1-induced gingival fibroblast-myofibroblast transition via inhibitory regulation of Smad2 and connective tissue growth factor.
20971063 2010 Connective tissue growth factor is a substrate of ADAM28.
20966418 2010 Connective tissue growth factor is associated with a stable atherosclerotic plaque phenotype and is involved in plaque stabilization after stroke.
20840672 2010 Connective tissue growth factor expression is increased in collagenous colitis and coeliac disease.
20814177 2010 Connective tissue growth factor cooperates with fibronectin in enhancing attachment and migration of corneal epithelial cells.
20731800 Regulation of fibroblast gene expression by keratinocytes in organotypic skin culture provides possible mechanisms for the antifibrotic effect of reepithelialization.
20697347 2010 The reactive tumor microenvironment: MUC1 signaling directly reprograms transcription of CTGF.
20689330 2011 Involvement of connective tissue growth factor in human and experimental hypertensive nephrosclerosis.
20685720 2010 Differential expression profiling analyses identifies downregulation of 1p, 6q, and 14q genes and overexpression of 6p histone cluster 1 genes as markers of recurrence in meningiomas.
20660557 2010 Connective tissue growth factor expression in endocrine tumors is associated with high stromal expression of alpha-smooth muscle actin.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20613589 2010 Elucidating mechanisms of osteogenesis in human adipose-derived stromal cells via microarray analysis.
20576680 2010 Expression patterns of connective tissue growth factor and of TGF-beta isoforms during glomerular injury recapitulate glomerulogenesis.
20522536 2010 Phase 1 study of anti-CTGF monoclonal antibody in patients with diabetes and microalbuminuria.
20522428 2010 Genetic variant in the promoter of connective tissue growth factor gene confers susceptibility to nephropathy in type 1 diabetes.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20305691 2010 De-repression of CTGF via the miR-17-92 cluster upon differentiation of human glioblastoma spheroid cultures.
20238043 2010 Impaired intracellular signaling may allow up-regulation of CTGF-synthesis and secondary peri-retinal fibrosis in human retinal pigment epithelial cells from patients with age-related macular degeneration.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237235 2010 Renal proximal tubular dysfunction is a major determinant of urinary connective tissue growth factor excretion.
20222112 2010 Regulation of CCN2/connective tissue growth factor expression in the nucleus pulposus of the intervertebral disc: role of Smad and activator protein 1 signaling.
20201953 2010 Akt inhibition up-regulates MMP1 through a CCN2-dependent pathway in human dermal fibroblasts.
20180416 2009 [Expressions of ATF3 and CTGF and their regulation by estradiol in the prepuce of hypospadias patients].
20162579 2010 Connective tissue growth factor associated with oncogenic activities and drug resistance in glioblastoma multiforme.
20117462 2010 Rac1-induced connective tissue growth factor regulates connexin 43 and N-cadherin expression in atrial fibrillation.
20056838 2010 Involvement of CYR61 and CTGF in the fascin-mediated proliferation and invasiveness of esophageal squamous cell carcinomas cells.
20053285 2010 Plasma CCN2/connective tissue growth factor is associated with right ventricular dysfunction in patients with neuroendocrine tumors.
20050020 2009 Hedgehog signaling maintains hair follicle stem cell phenotype in young and aged human skin.
20032117 2010 Characterization of connective tissue growth factor expression in primary cultures of human tubular epithelial cells: modulation by hypoxia.
20032097 2010 Association between a CTGF gene polymorphism and systemic sclerosis in a French population.
20018872 2010 FoxO proteins mediate hypoxic induction of connective tissue growth factor in endothelial cells.
20015945 2010 Connective tissue growth factor (CTGF/CCN2) is increased in peritoneal dialysis patients with high peritoneal solute transport rate.
20008146 2010 alpha2-antiplasmin is associated with the progression of fibrosis.
20004937 2010 Post-mortem pathologic and genetic studies in "dead in bed syndrome" cases in type 1 diabetes mellitus.
19955828 2010 Connective tissue growth factor-(CTGF, CCN2)--a marker, mediator and therapeutic target for renal fibrosis.
19922639 2009 Connective tissue growth factor promotes articular damage by increased osteoclastogenesis in patients with rheumatoid arthritis.
19895313 2009 Modulation of migration and Ca2+ signaling in retinal pigment epithelium cells by recombinant human CTGF.
19893244 2009 Inhibition effect of short hairpin RNA of transforming growth factor beta1 on cytokines expression induced by albumin in HK2 cells.
19890996 2010 Hyaluronic acid modulates gene expression of connective tissue growth factor (CTGF), transforming growth factor-beta1 (TGF-beta1), and vascular endothelial growth factor (VEGF) in human fibroblast-like synovial cells from advanced-stage osteoarthritis in vitro.
19863391 2009 Cyclical cell stretching of skin-derived fibroblasts downregulates connective tissue growth factor (CTGF) production.
19861250 2009 [Effects of small interfering RNA targeting connective tissue growth factor on high glucose-induced human tubular epithelial hypertrophy].
19822645 2009 Variants of CTGF are associated with hepatic fibrosis in Chinese, Sudanese, and Brazilians infected with schistosomes.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19764567 2009 [Role of collagen III, CTGF and TNF-alpha in premature rupture of human fetal membranes].
19764552 2009 [The effect or rosiglitazone on signal pathways of transforming growth factor-beta1 in human lung fibroblast].
19762080 2009 The expression of connective tissue growth factor in pregnancies complicated by severe preeclampsia or fetal growth restriction.
19730442 2010 Caspase-3-mediated secretion of connective tissue growth factor by apoptotic endothelial cells promotes fibrosis.
19724859 2009 Gene expression profile of residual breast cancer after doxorubicin and cyclophosphamide neoadjuvant chemotherapy.
19673024 2009 Connective tissue growth factor hammerhead ribozyme attenuates human hepatic stellate cell function.
19670427 2009 Susceptibility to liver fibrosis in mice expressing a connective tissue growth factor transgene in hepatocytes.
19657322 2009 Transforming growth factor-beta2 upregulates sphingosine kinase-1 activity, which in turn attenuates the fibrotic response to TGF-beta2 by impeding CTGF expression.
19641518 2010 Reduced expression of connective tissue growth factor (CTGF/CCN2) mediates collagen loss in chronologically aged human skin.
19625611 2009 Adverse effects of high glucose and free fatty acid on cardiomyocytes are mediated by connective tissue growth factor.
19589256 The role of c-Jun N-terminal kinases 1/2 in transforming growth factor beta(1)-induced expression of connective tissue growth factor and scar formation in the cornea.
19565505 2009 Pivotal role of connective tissue growth factor in lung fibrosis: MAPK-dependent transcriptional activation of type I collagen.
19549692 2009 Hypoxia interferes with connective tissue growth factor (CTGF) gene expression in human proximal tubular cell lines.
19494553 2009 Tgf-beta auto-induction and connective tissue growth factor expression in human renal tubule epithelial cells requires N-ras.
19485899 2010 The axis of thrombospondin-1, transforming growth factor beta and connective tissue growth factor: an emerging therapeutic target in rheumatoid arthritis.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19429239 2009 15-deoxy-Delta(12,14)-prostaglandin J(2) inhibits fibrogenic response in human hepatoma cells.
19409809 2009 Urinary monocyte chemoattractant protein-1 (MCP-1) and connective tissue growth factor (CCN2) as prognostic markers for progression of diabetic nephropathy.
19382180 2009 Downregulation of connective tissue growth factor by three-dimensional matrix enhances ovarian carcinoma cell invasion.
19378419 2008 Signal transduction involved in CTGF-induced production of chemokines in mesangial cells.
19333718 2010 Connective tissue growth factor is a downstream mediator for preptin-induced proliferation and differentiation in human osteoblasts.
19301259 2009 CTGF enhances migration and MMP-13 up-regulation via alphavbeta3 integrin, FAK, ERK, and NF-kappaB-dependent pathway in human chondrosarcoma cells.
19298220 2009 N-terminal domains of CCN family 2/connective tissue growth factor bind to aggrecan.
19277979 2009 Role of connective tissue growth factor and its interaction with basic fibroblast growth factor and macrophage chemoattractant protein-1 in skin fibrosis.
19253834 2008 [Expression of connective tissue growth factor in skin lesions in patients with scleroderma].
19247157 2009 Expression and role of connective tissue growth factor in painful disc fibrosis and degeneration.
19243500 2009 Validation of connective tissue growth factor (CTGF/CCN2) and its gene polymorphisms as noninvasive biomarkers for the assessment of liver fibrosis.
19233176 2009 Regulation of chondrocytic phenotype by micro RNA 18a: involvement of Ccn2/Ctgf as a major target gene.
19218111 2009 [Effect of high glucose exposure on connective tissue growth factor expression in cultured human renal tubular epithelial cells and the role of p38MAPK pathway].
19210343 2009 Effect of transforming growth factor-beta1 on expression of the connective tissue growth factor (CCN2/CTGF) gene in normal human gingival fibroblasts and periodontal ligament cells.
19208517 2009 Hepatitis B virus X protein promotes proliferation and upregulates TGF-beta1 and CTGF in human hepatic stellate cell line, LX-2.
19179545 2009 The role of tumor cell-derived connective tissue growth factor (CTGF/CCN2) in pancreatic tumor growth.
19153601 2009 Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF.
19096030 2009 miR-133 and miR-30 regulate connective tissue growth factor: implications for a role of microRNAs in myocardial matrix remodeling.
19069651 2008 [Study on expression of CTGF and WISP-1 genes in human lung cancers].
19054818 2009 Association study of a polymorphism of the CTGF gene and susceptibility to systemic sclerosis in the Japanese population.
19054816 2009 A large multicentre analysis of CTGF -945 promoter polymorphism does not confirm association with systemic sclerosis susceptibility or phenotype.
19016368 2008 Connective tissue growth factor expression in human intervertebral disc: implications for angiogenesis in intervertebral disc degeneration.
18936953 2009 Ligand-induced nuclear translocation of S1P(1) receptors mediates Cyr61 and CTGF transcription in endothelial cells.
18922980 2008 Induction of antiproliferative connective tissue growth factor expression in Wilms' tumor cells by sphingosine-1-phosphate receptor 2.
18922143 2008 Bile acids induce CCN2 production through p38 MAP kinase activation in human bronchial epithelial cells: a factor contributing to airway fibrosis.
18846327 2008 High glucose promotes the CTGF expression in human mesangial cells via serum and glucocorticoid-induced kinase 1 pathway.
18836231 2008 Role of mechanical-stress inducible protein Hcs24/CTGF/CCN2 in cartilage growth and regeneration: mechanical stress induces expression of Hcs24/CTGF/CCN2 in a human chondrocytic cell line HCS-2/8, rabbit costal chondrocytes and meniscus tissue cells.
18835464 2009 CCN family 2/connective tissue growth factor (CCN2/CTGF) regulates the expression of Vegf through Hif-1alpha expression in a chondrocytic cell line, HCS-2/8, under hypoxic condition.
18805993 2009 Regulation of CCN2/CTGF and related cytokines in cultured peritoneal cells under conditions simulating peritoneal dialysis.
18787533 2009 Cell permeant peptide analogues of the small heat shock protein, HSP20, reduce TGF-beta1-induced CTGF expression in keloid fibroblasts.
18783549 2008 Connective tissue growth factor: a fibrogenic master switch in fibrotic liver diseases.
18683703 2008 [Influence of ASODN to the human tenon's fibroblasts in expressing CTGF induced by transforming growth factor beta2].
18676875 2008 Proteomic analysis of CTGF-activated lung fibroblasts: identification of IQGAP1 as a key player in lung fibroblast migration.
18648180 2008 Increased expression of connective tissue growth factor in patients with urethral stricture.
18639630 2008 Molecular insights into connective tissue growth factor action in rat pancreatic stellate cells.
18628999 2008 The angio-fibrotic switch of VEGF and CTGF in proliferative diabetic retinopathy.
18622762 2008 Connective tissue growth factor (CTGF) and cancer progression.
18596209 2008 Connective tissue growth factor inhibits adipocyte differentiation.
18481257 2008 Neutralizing monoclonal antibody to human connective tissue growth factor ameliorates transforming growth factor-beta-induced mouse fibrosis.
18451226 2008 Serial analysis of gene expression identifies connective tissue growth factor expression as a prognostic biomarker in gallbladder cancer.
18400984 2008 Specific signals involved in the long-term maintenance of radiation-induced fibrogenic differentiation: a role for CCN2 and low concentration of TGF-beta1.
18395916 2008 Expression of connective tissue growth factor in tumor tissues is an independent predictor of poor prognosis in patients with gastric cancer.
18358427 2008 Regulation and function of connective tissue growth factor/CCN2 in tissue repair, scarring and fibrosis.
18344285 2008 Plasma connective tissue growth factor is an independent predictor of end-stage renal disease and mortality in type 1 diabetic nephropathy.
18319604 2008 SGK1-dependent upregulation of connective tissue growth factor by angiotensin II.
18292194 2008 Hypoxia in human trophoblasts stimulates the expression and secretion of connective tissue growth factor.
18287089 2008 Transforming growth factor-beta1 (TGFbeta1) stimulates connective tissue growth factor (CCN2/CTGF) expression in human gingival fibroblasts through a RhoA-independent, Rac1/Cdc42-dependent mechanism: statins with forskolin block TGFbeta1-induced CCN2/CTGF expression.
18266973 2008 Activation of TGF-beta within cultured hepatocytes and in liver injury leads to intracrine signaling with expression of connective tissue growth factor.
18264937 TGF-beta1 and CTGF mRNAs are correlated with urinary protein level in IgA nephropathy.
18245529 2008 Prognostic value of CCN3 in osteosarcoma.
18212329 2008 Cyr61/CCN1 and CTGF/CCN2 mediate the proangiogenic activity of VHL-mutant renal carcinoma cells.
18172013 2008 Novel transcription-factor-like function of human matrix metalloproteinase 3 regulating the CTGF/CCN2 gene.
18080105 2008 CCN2, the connective tissue growth factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17996907 2008 Connective tissue growth factor is overexpressed in muscles of human muscular dystrophy.
17951996 2008 Inhibition of integrin-linked kinase via a siRNA expression plasmid attenuates connective tissue growth factor-induced human proximal tubular epithelial cells to mesenchymal transition.
17951630 2007 Connective tissue growth factor is overexpressed in esophageal squamous cell carcinoma and promotes tumorigenicity through beta-catenin-T-cell factor/Lef signaling.
17944991 2008 Homocysteine induces connective tissue growth factor expression in vascular smooth muscle cells.
17922682 2007 Expression of connective tissue growth factor is in agreement with the expression of VEGF, VEGF-C, -D and associated with shorter survival in gastric cancer.
17915216 2008 TGFbeta stimulated re-epithelialisation is regulated by CTGF and Ras/MEK/ERK signalling.
17908800 2007 Identification of candidate angiogenic inhibitors processed by matrix metalloproteinase 2 (MMP-2) in cell-based proteomic screens: disruption of vascular endothelial growth factor (VEGF)/heparin affin regulatory peptide (pleiotrophin) and VEGF/Connective tissue growth factor angiogenic inhibitory complexes by MMP-2 proteolysis.
17881752 2007 A polymorphism in the CTGF promoter region associated with systemic sclerosis.
17876891 2007 CTGF, intestinal stellate cells and carcinoid fibrogenesis.
17786299 2007 Expression of connective tissue growth factor in pancreatic cancer cell lines.
17765657 2008 Bacteria induce CTGF and CYR61 expression in epithelial cells in a lysophosphatidic acid receptor-dependent manner.
17681742 2007 Endogenous endothelin-1 signaling contributes to type I collagen and CCN2 overexpression in fibrotic fibroblasts.
17673559 2007 A single bout of exercise with high mechanical loading induces the expression of Cyr61/CCN1 and CTGF/CCN2 in human skeletal muscle.
17671176 2007 Promoter hypermethylation contributes to frequent inactivation of a putative conditional tumor suppressor gene connective tissue growth factor in ovarian cancer.
17657819 2007 Profibrogenic transforming growth factor-beta/activin receptor-like kinase 5 signaling via connective tissue growth factor expression in hepatocytes.
17622321 Expression of connective tissue growth factor in the human liver with idiopathic portal hypertension.
17602195 2007 Aldosterone induces CTGF in mesangial cells by activation of the glucocorticoid receptor.
17580150 2007 Protective effects of sirolimus by attenuating connective tissue growth factor expression in human chronic allograft nephropathy.
17579708 2007 Expression of Cyr61, CTGF, and WISP-1 correlates with clinical features of lung cancer.
17550972 2007 CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway.
17498677 2007 Role of ERK1/2 and PI3-K in the regulation of CTGF-induced ILK expression in HK-2 cells.
17441427 2007 [Expression of connective tissue growth factor (CTGF), osteopontin (OPN) and clinical significances in the laryngeal squamous cell carcinoma tissues].
17437852 2007 Up-regulation of estrogen responsive genes in hypospadias: microarray analysis.
17399955 2007 The up-regulation of angiotensin II receptor type 1 and connective tissue growth factor are involved in high-glucose-induced fibronectin production by cultured human dermal fibroblasts.
17399683 2007 Promotion of attachment of human bone marrow stromal cells by CCN2.
17393107 2007 Role of connective tissue growth factor in extracellular matrix degradation in renal tubular epithelial cells.
17375628 2007 Analysis of connective tissue growth factor promoter polymorphism in Thai children with biliary atresia.
17239853 2007 CCN2 is necessary for the function of mouse embryonic fibroblasts.
17239539 2007 Connective tissue growth factor binds to fibronectin through the type I repeat modules and enhances the affinity of fibronectin to fibrin.
17224075 2007 High glucose upregulates connective tissue growth factor expression in human vascular smooth muscle cells.
17215322 2007 Actin-dependent regulation of connective tissue growth factor.
17192487 2007 Transforming growth factor-beta2 and connective tissue growth factor in proliferative vitreoretinal diseases: possible involvement of hyalocytes and therapeutic potential of Rho kinase inhibitor.
17170128 2007 Connective tissue growth factor (CTGF) expression and outcome in adult patients with acute lymphoblastic leukemia.
17119035 2006 Prognostic value of PAI1 in invasive breast cancer: evidence that tumor-specific factors are more important than genetic variation in regulating PAI1 expression.
17116388 2007 Inhibitory effects of interferon-gamma on activation of rat pancreatic stellate cells are mediated by STAT1 and involve down-regulation of CTGF expression.
17093396 2006 Regulation of connective tissue growth factor expression in the aqueous humor outflow pathway.
16899928 2006 Connective tissue growth factor is released from platelets under high shear stress and is differentially expressed in endothelium along atherosclerotic plaques.
16889607 2006 Connective tissue growth factor is a biomarker and mediator of kidney allograft fibrosis.
16877704 2006 Suppression of cell proliferation and signaling transduction by connective tissue growth factor in non-small cell lung cancer cells.
16858645 2005 Relationship of five inflammatory gene polymorphisms with morbidity and mortality in 533 patients admitted to an ICU.
16820572 2006 Increased collagen deposition and elevated expression of connective tissue growth factor in human thoracic aortic dissection.
16813525 2006 Pathogenic role of connective tissue growth factor (CTGF/CCN2) in osteolytic metastasis of breast cancer.
16790529 2006 Connective tissue growth factor/CCN2 stimulates actin disassembly through Akt/protein kinase B-mediated phosphorylation and cytoplasmic translocation of p27(Kip-1).
16731742 2006 Connective tissue growth factor-specific antibody attenuates tumor growth, metastasis, and angiogenesis in an orthotopic mouse model of pancreatic cancer.
16684954 2006 Modulation by bradykinin of angiotensin type 1 receptor-evoked RhoA activation of connective tissue growth factor expression in human lung fibroblasts.
16543635 2006 Effects of human connective tissue growth factor gene transfection on migration of human umbilical vein endothelial cell.
16528248 2006 Tranilast attenuates connective tissue growth factor-induced extracellular matrix accumulation in renal cells.
16501850 2006 Resequencing of the characterised CTGF gene to identify novel or known variants, and analysis of their association with diabetic nephropathy.
16482098 2006 Losartan improves resistance artery lesions and prevents CTGF and TGF-beta production in mild hypertensive patients.
16457822 2006 CT domain of CCN2/CTGF directly interacts with fibronectin and enhances cell adhesion of chondrocytes through integrin alpha5beta1.
16373901 2006 Urinary connective tissue growth factor excretion correlates with clinical markers of renal disease in a large population of type 1 diabetic patients with diabetic nephropathy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16291159 2005 Connective tissue growth factor expression is increased in biliary epithelial cells in biliary atresia.
16270194 2005 Glomerular expression of thrombospondin-1, transforming growth factor beta and connective tissue growth factor at different stages of diabetic nephropathy and their interdependent roles in mesangial response to diabetic stimuli.
16255854 2005 [Expression of connective tissue growth factor in progressive muscular dystrophy].
16247469 2006 Hypoxic regulation of stability of connective tissue growth factor/CCN2 mRNA by 3'-untranslated region interacting with a cellular protein in human chondrosarcoma cells.
16204411 2006 TGF-beta1 induces IL-8 and MCP-1 through a connective tissue growth factor-independent pathway.
16186174 2005 Connective tissue growth factor (CTGF) expression in the brain is a downstream effector of insulin resistance- associated promotion of Alzheimer's disease beta-amyloid neuropathology.
16044512 2005 Translational repression by the cis-acting element of structure-anchored repression (CAESAR) of human ctgf/ccn2 mRNA.
15956925 2005 The expression of platelet-derived growth factor and connective tissue growth factor in different types of abdominal aortic aneurysms.
15950619 2005 Modulation of the TGFbeta/Smad signaling pathway in mesangial cells by CTGF/CCN2.
15941869 2005 Connective tissue growth factor expression in the human corpus luteum: paracrine regulation by human chorionic gonadotropin.
15940639 2005 Role of connective tissue growth factor in oval cell response during liver regeneration after 2-AAF/PHx in rats.
15857887 2005 Individual domains of connective tissue growth factor regulate fibroblast proliferation and myofibroblast differentiation.
15820145 2005 Collaborative action of M-CSF and CTGF/CCN2 in articular chondrocytes: possible regenerative roles in articular cartilage metabolism.
15761249 2005 Monocrotaline-induced pulmonary hypertension correlates with upregulation of connective tissue growth factor expression in the lung.
15761189 2005 Connective tissue growth factor is overexpressed in complicated atherosclerotic plaques and induces mononuclear cell chemotaxis in vitro.
15703175 2005 Na+/Ca2+ exchanger activity modulates connective tissue growth factor mRNA expression in transforming growth factor beta1- and Des-Arg10-kallidin-stimulated myofibroblasts.
15598883 2004 Abundant retention and release of connective tissue growth factor (CTGF/CCN2) by platelets.
15536170 2005 Integrated actions of transforming growth factor-beta1 and connective tissue growth factor in renal fibrosis.
15526358 2004 Expressions of cysteine-rich61, connective tissue growth factor and Nov genes in hepatocellular carcinoma and their clinical significance.
15459777 2005 Connective tissue growth factor and progressive fibrosis in biliary atresia.
15377500 2005 Regulation of TGF-beta 1-induced connective tissue growth factor expression in airway smooth muscle cells.
15345671 2004 Connective tissue growth factor mediates high glucose effects on matrix degradation through tissue inhibitor of matrix metalloproteinase type 1: implications for diabetic nephropathy.
15298857 2004 Connective tissue growth factor expression and induction by transforming growth factor-beta is abrogated by simvastatin via a Rho signaling mechanism.
15247510 2004 Transcriptional profiling of the scleroderma fibroblast reveals a potential role for connective tissue growth factor (CTGF) in pathological fibrosis.
15135656 2004 Role of connective tissue growth factor in renal tubular epithelial-myofibroblast transdifferentiation and extracellular matrix accumulation in vitro.
15113833 2004 Module-specific antibodies against human connective tissue growth factor: utility for structural and functional analysis of the factor as related to chondrocytes.
15111539 2004 Connective tissue growth factor is increased in plasma of type 1 diabetic patients with nephropathy.
15090860 2004 Connective tissue growth factor and renal diseases: some answers, more questions.
15053922 2004 Three members of the connective tissue growth factor family CCN are differentially regulated by mechanical stress.
15045137 2004 Activated human platelets release connective tissue growth factor.
15041728 2004 Levels of expression of CYR61 and CTGF are prognostic for tumor progression and survival of individuals with gliomas.
15039132 2004 The amount of calcium-deficient hexagonal hydroxyapatite in aortic valves is influenced by gender and associated with genetic polymorphisms in patients with severe calcific aortic stenosis.
15003992 2004 Combinatorial signaling pathways determine fibroblast proliferation and myofibroblast differentiation.
14996858 2004 Connective tissue growth factor and its role in lung adenocarcinoma invasion and metastasis.
14988298 2004 Accumulation of NH2-terminal fragment of connective tissue growth factor in the vitreous of patients with proliferative diabetic retinopathy.
14758550 2004 In situ expression of connective tissue growth factor in human crescentic glomerulonephritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684735 2004 Connective tissue growth factor (CCN2) induces adhesion of rat activated hepatic stellate cells by binding of its C-terminal domain to integrin alpha(v)beta(3) and heparan sulfate proteoglycan.
14633859 2003 Connective tissue growth factor and igf-I are produced by human renal fibroblasts and cooperate in the induction of collagen production by high glucose.
14585398 2003 Low density lipoprotein receptor-related protein (LRP) is a heparin-dependent adhesion receptor for connective tissue growth factor (CTGF) in rat activated hepatic stellate cells.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14512169 2003 Angiogenic proteins in brains of patients who died with cerebral malaria.
12951326 2003 Modulation of the expression of connective tissue growth factor by alterations of the cytoskeleton.
12941731 2003 Urinary connective tissue growth factor excretion in patients with type 1 diabetes and nephropathy.
12888575 2003 Constitutive connective tissue growth factor expression in scleroderma fibroblasts is dependent on Sp1.
12831056 2002 Regulation of angiogenesis and endothelial cell function by connective tissue growth factor (CTGF) and cysteine-rich 61 (CYR61).
12811819 2003 CTGF/Hcs24, hypertrophic chondrocyte-specific gene product, interacts with perlecan in regulating the proliferation and differentiation of chondrocytes.
12787426 2003 Connective tissue growth factor and its regulation in the peritoneal cavity of peritoneal dialysis patients.
12760970 2003 C-Jun-NH2-terminal kinase mediates expression of connective tissue growth factor induced by transforming growth factor-beta1 in human lung fibroblasts.
12668285 2003 Suppressive effect of overexpressed connective tissue growth factor on tumor cell growth in a human oral squamous cell carcinoma-derived cell line.
12595495 2003 CTGF mediates TGF-beta-induced fibronectin matrix deposition by upregulating active alpha5beta1 integrin in human mesangial cells.
12571253 2003 Connective tissue growth factor gene regulation. Requirements for its induction by transforming growth factor-beta 2 in fibroblasts.
12553878 2003 The heparin-binding 10 kDa fragment of connective tissue growth factor (CTGF) containing module 4 alone stimulates cell adhesion.
12535930 2003 Connective tissue growth factor in Alzheimer's disease.
12496395 2003 Human gamma delta-T lymphocytes express and synthesize connective tissue growth factor: effect of IL-15 and TGF-beta 1 and comparison with alpha beta-T lymphocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470643 2002 CTGF/Hcs24 interacts with the cytoskeletal protein actin in chondrocytes.
12398938 2002 Expression of connective tissue growth factor/hypertrophic chondrocyte-specific gene product 24 (CTGF/Hcs24) during fracture healing.
12297288 2002 Tyrosine kinase-type receptor ErbB4 in chondrocytes: interaction with connective tissue growth factor and distribution in cartilage.
12239232 2002 Connective tissue growth factor and regulation of the mesangial cell cycle: role in cellular hypertrophy.
12218048 2002 The role of p42/44 MAPK and protein kinase B in connective tissue growth factor induced extracellular matrix protein production, cell migration, and actin cytoskeletal rearrangement in human mesangial cells.
12217862 2002 TGF-beta and CTGF have overlapping and distinct fibrogenic effects on human renal cells.
12150969 2002 A novel cis-element that enhances connective tissue growth factor gene expression in chondrocytic cells.
12114504 2002 Matrix metalloproteinases cleave connective tissue growth factor and reactivate angiogenic activity of vascular endothelial growth factor 165.
12036876 2002 Identification of integrin alpha(M)beta(2) as an adhesion receptor on peripheral blood monocytes for Cyr61 (CCN1) and connective tissue growth factor (CCN2): immediate-early gene products expressed in atherosclerotic lesions.
11967989 2002 Interleukin-4 regulates connective tissue growth factor expression in human lung fibroblasts.
11818516 2002 Gonadotrophins inhibit the expression of insulin-like growth factor binding protein-related protein-2 mRNA in cultured human granulosa-luteal cells.
11751417 2001 Elevated levels of connective tissue growth factor, WISP-1, and CYR61 in primary breast cancers associated with more advanced features.
11744618 2002 Connective tissue growth factor binds vascular endothelial growth factor (VEGF) and inhibits VEGF-induced angiogenesis.
11697887 2001 Connective tissue growth factor is secreted through the Golgi and is degraded in the endosome.
11532378 2001 Serum levels of interleukin-6 and interleukin-10 correlate with total skin thickness score in patients with systemic sclerosis.
11502477 2001 Novel mode of processing and secretion of connective tissue growth factor/ecogenin (CTGF/Hcs24) in chondrocytic HCS-2/8 cells.
11101692 2000 Localization of connective tissue growth factor in human uterine tissues.
10809757 2000 Tumor necrosis factor alpha suppresses the induction of connective tissue growth factor by transforming growth factor-beta in normal and scleroderma fibroblasts.
10614647 2000 Effects of CTGF/Hcs24, a product of a hypertrophic chondrocyte-specific gene, on the proliferation and differentiation of chondrocytes in culture.
10457363 1999 Role and interaction of connective tissue growth factor with transforming growth factor-beta in persistent fibrosis: A mouse fibrosis model.
10350062 1999 Involvement of cis-acting repressive element(s) in the 3'-untranslated region of human connective tissue growth factor gene.
10204117 1999 The connective tissue growth factor/cysteine-rich 61/nephroblastoma overexpressed (CCN) family.
9927660 1999 The C-terminal domain of the regulatory protein NOVH is sufficient to promote interaction with fibulin 1C: a clue for a role of NOVH in cell-adhesion signaling.
9371786 1997 Identification of a family of low-affinity insulin-like growth factor binding proteins (IGFBPs): characterization of connective tissue growth factor as a member of the IGFBP superfamily.
9242708 1997 Purification and characterization of novel heparin-binding growth factors in uterine secretory fluids. Identification as heparin-regulated Mr 10,000 forms of connective tissue growth factor.
9054739 1997 Human connective tissue growth factor is expressed in advanced atherosclerotic lesions.
1925598 1991 Targets for dioxin: genes for plasminogen activator inhibitor-2 and interleukin-1 beta.
1756408 1991 Expression of a gene encoding a novel potential IGF binding protein in human tissues.
1654338 1991 Connective tissue growth factor: a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.
1334251 1992 Physical mapping of human loci homologous to the chicken nov proto-oncogene.
1293144 1992 Connective tissue growth factor.