Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.63
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.949 3.3e-04
ependymoma 1.300 4.7e-04
group 4 medulloblastoma 2.700 4.3e-06
atypical teratoid / rhabdoid tumor 2.000 6.0e-05
glioblastoma 1.300 2.8e-02
medulloblastoma, large-cell 2.500 3.8e-07
primitive neuroectodermal tumor 1.300 2.9e-04
primary pancreatic ductal adenocarcinoma 1.035 8.8e-03
tuberculosis and treatment for 6 months 1.100 3.5e-03
non-small cell lung cancer 1.046 3.3e-08
intraductal papillary-mucinous neoplasm ... 1.300 5.4e-03
pediatric high grade glioma 1.100 2.9e-02
Pick disease -1.200 4.6e-05
ovarian cancer -1.200 4.8e-05
pituitary cancer 1.300 2.0e-05

Gene RIF (1)

PMID Text
20932329 increases epsilon- and gamma-globin gene expression during erythroid differentiation

AA Sequence

MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSK      1 - 70
RSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTL     71 - 140
LGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPS    141 - 210
LNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPL    211 - 280
KTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTA    281 - 350
SKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPI    351 - 420
ESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD                            421 - 466
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20932329 2010 CTD small phosphatase like 2 (CTDSPL2) can increase ?- and ?-globin gene expression in K562 cells and CD34+ cells derived from umbilical cord blood.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.