Property Summary

NCBI Gene PubMed Count 15
PubMed Score 50.15
PubTator Score 6.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.400 1.1e-03
glioblastoma 1.600 1.2e-05
atypical teratoid / rhabdoid tumor 1.100 4.3e-06
tuberculosis -1.600 1.0e-07
adult high grade glioma 1.400 1.4e-03
Pick disease 1.100 3.9e-03
progressive supranuclear palsy 1.400 2.0e-02
ovarian cancer -1.500 3.3e-09

Gene RIF (3)

PMID Text
25990325 CTDSP2 induces p21(Cip1/Waf1) through increasing the activity of Ras.
17085434 SCP2 acts as a phosphatase for regulatory phosphorylations in the linker region of Smad1 and Smad2
16724108 These results suggest that SCP2 is involved in promoter clearance during steroid-activated transcription.

AA Sequence

MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIA      1 - 70
KSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYV     71 - 140
LKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDL    141 - 210
RKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP             211 - 271
//

Text Mined References (19)

PMID Year Title
25990325 2015 FOXO target gene CTDSP2 regulates cell cycle progression through Ras and p21(Cip1/Waf1).
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
18058037 2007 Structural genomics of protein phosphatases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17085434 2006 Dephosphorylation of the linker regions of Smad1 and Smad2/3 by small C-terminal domain phosphatases has distinct outcomes for bone morphogenetic protein and transforming growth factor-beta pathways.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16724108 2006 Small carboxyl-terminal domain phosphatase 2 attenuates androgen-dependent transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15681389 2005 Small CTD phosphatases function in silencing neuronal gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12721286 2003 A novel RNA polymerase II C-terminal domain phosphatase that preferentially dephosphorylates serine 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9315096 1997 Characterization of a highly conserved gene (OS4) amplified with CDK4 in human sarcomas.
8673473 1995 A strategy for cloning the hereditary hemochromatosis gene.
8090779 1994 Direct isolation of genes encoded within a homogeneously staining region by chromosome microdissection.