Property Summary

NCBI Gene PubMed Count 21
PubMed Score 25.91
PubTator Score 19.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 3.7e-07
glioblastoma 5572 2.8e-05
pediatric high grade glioma 2712 2.9e-05
psoriasis 6685 1.0e-04
osteosarcoma 7933 2.4e-03

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 1.0e-04
osteosarcoma -1.539 2.4e-03
glioblastoma 1.300 2.8e-05
pediatric high grade glioma 1.100 2.9e-05
pilocytic astrocytoma 1.100 3.7e-07

Protein-protein Interaction (10)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
493091 screening 2991 / 0 / 337938 uHTS Colorimetric assay for identification of inhibitors of Scp-1
493120 summary 0 / 0 / 0 Summary assay for small molecule Inhibitors of SCP-1
540281 screening 1487 / 0 / 965 Single concentration confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay
540297 confirmatory 1000 / 0 / 11 Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay
540313 screening 0 / 0 / 2452 Single concentration colorimetric interference counterscreen of uHTS hits for Scp-1 phosphatase
540329 other 378 / 0 / 1109 Differential Scanning Fluorimetry (Thermal Shift) Binding Assay for validation of Inhibitors of Scp-1 phosphatase

Gene RIF (11)

PMID Text
25893300 SCP1 regulates c-Myc stability and functions through dephosphorylating c-Myc Serine-62.
25197063 CTDSP1 activity stabilizes REST in stem cells and ERK-dependent phosphorylation combined with Pin1 activity promotes REST degradation in neural progenitors.
25081999 hSCP1 may be an beta-O-linked N-acetylglucosamine modified protein in vivo.
24769477 SCP1 phosphatase substrate specificity: CdcA3 could be an enzymatic substrate for SCP1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20222012 Captured the phosphoryl-aspartate intermediate in the crystal structure of a Scp1D206A mutant soaked with para-nitrophenyl phosphate (pNPP), providing strong evidence for the proposed mechanism.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17085434 SCP1 acts as a phosphatase for regulatory phosphorylations in the linker region of Smad1 and Smad2.
15681389 results show that REST/NRSF recruits SCPs to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells
12721286 SCP1 may play a role in the regulation of gene expression, possibly by controlling the transition from initiation/capping to processive transcript elongation
11950066 Polymorphisms vary significantly between races; Not associated with TB susceptibility in Caucasians.

AA Sequence

MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAI      1 - 70
PKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQ     71 - 140
RMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPA    141 - 210
SYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS                       211 - 261
//

Text Mined References (25)

PMID Year Title
25893300 2016 SCP1 regulates c-Myc stability and functions through dephosphorylating c-Myc Ser62.
25416956 2014 A proteome-scale map of the human interactome network.
25197063 2014 C-terminal domain small phosphatase 1 and MAP kinase reciprocally control REST stability and neuronal differentiation.
25081999 2014 In vivo putative O-GlcNAcylation of human SCP1 and evidence for possible role of its N-terminal disordered structure.
24769477 2014 A study of substrate specificity for a CTD phosphatase, SCP1, by proteomic screening of binding partners.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21348431 2011 Selective inactivation of a human neuronal silencing phosphatase by a small molecule inhibitor.
21239611 2011 Suppression of BMP-Smad signaling axis-induced osteoblastic differentiation by small C-terminal domain phosphatase 1, a Smad phosphatase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20222012 2010 Structural and functional analysis of the phosphoryl transfer reaction mediated by the human small C-terminal domain phosphatase, Scp1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17157258 2006 Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.
17085434 2006 Dephosphorylation of the linker regions of Smad1 and Smad2/3 by small C-terminal domain phosphatases has distinct outcomes for bone morphogenetic protein and transforming growth factor-beta pathways.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15681389 2005 Small CTD phosphatases function in silencing neuronal gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304220 2004 Structure and mechanism of RNA polymerase II CTD phosphatases.
12721286 2003 A novel RNA polymerase II C-terminal domain phosphatase that preferentially dephosphorylates serine 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11950066 2002 Ethnic divergence and linkage disequilibrium of novel SNPs in the human NLI-IF gene: evidence of human origin and lack of association with tuberculosis susceptibility.
10967134 2000 Complete nucleotide sequence and genomic structure of the human NRAMP1 gene region on chromosome region 2q35.