Property Summary

NCBI Gene PubMed Count 54
PubMed Score 41.11
PubTator Score 119.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.0e-03
Disease Target Count Z-score Confidence
Cancer 2346 3.33 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.400 6.0e-03

 GO Component (2)

Gene RIF (46)

PMID Text
26185996 BORIS is associated with cancer stem cell-enriched populations of several epithelial tumor cells and the different phenotypes depend on the origin of tumor cells.
26125810 Data found that BORIS and CTCF expression in low-grade squamous intraepithelial lesions and invasive cervical carcinoma is higher than in normal samples. The possible utility of BORIS and CTCF as biomarkers in cervical neoplasm requires further analysis.
25499215 In the first detailed analysis in cancer, a marked loss of CHD8 expression and increased BORIS/CTCF ratio indicate frequent disruption of CTCF and its effector genes in PCa.
25363021 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
24984200 results provide novel insights into the determinants of NOTCH3 overexpression in cancer cells, by revealing a key role for BORIS as the main mediator of transcriptional deregulation of NOTCH3
24983365 The serum levels of MAGE-A and BORIS mRNA, as well as let-7b were significantly higher in patients.
24658009 CTCFL/BORIS was amongst the top ranked genes differentially expressed between endometrioid and non-endometrioid tumors, and increasing mRNA level of CTCFL/BORIS was highly significantly associated with poor survival.
24563233 High BORIS transcript variants are associated with laryngeal squamous cell carcinomas.
24279897 BORIS is an RNA-binding protein that associates with polysomes.
24123052 The ability of BORIS to activate the androgen receptor gene indicates BORIS involvement in the growth and development of prostate tumors.
23955684 Neither the MTHFR polymorphism, nor CTCFL mutations explain a pattern of sperm hypomethylation at paternally imprinting loci
23553099 CTCF and BORIS suppressed breast cancer growth; findings provide further evidence that CTCF behaves as a tumor suppressor, and show BORIS has a similar growth inhibitory effect in vitro and in vivo
23390377 The expression of BORIS isoform families in normal ovary (NO) and epithelial ovarian cancer.
23237599 our study has shown for the first time that BORIS is expressed in hepatocellular carcinoma (HCC) tissues, and its expression significantly correlates with poor prognosis and cd90 expression.
22792300 BORIS induces demethylation of the SBSN CpG island and disruption and activation of chromatin around the SBSN transcription start site, resulting in an increase in SBSN expression.
22724006 down-regulation of endogenous BORIS by specific shRNAs inhibited both RNA transcription and cell cycle progression. The results altogether suggest a role for BORIS in coordinating S phase events with mitosis.
22676270 BORIS may be a useful biomarker for prognostic diagnosis of ESCC patients and a potential target for treatment including by BORIS-specific immunotherapy and molecular target therapy.
22223638 Transcription of the ferT gene in colon cancer cells was found to be driven by an intronic promoter residing in intron 10 of the fer gene and to be regulated by the Brother of the Regulator of Imprinted Sites (BORIS) transcription factor.
22168535 This review summarizes what is known about BORIS regarding its expression, structure, and function.
21874228 a significant up-regulation of BORIS (p<0.001) and TSHZ1 transcripts (p<0.05) for JAs compared to nasal mucosa.
21811597 These findings show that BORIS expression is more widespread than previously believed, and suggest a role for BORIS in nucleolar function.
21558405 BORIS positively regulates these CTAs by binding and inducing a shift to a more open chromatin conformation with promoter demethylation
21495859 BORIS-MS2 alleles are transmitted through meiosis following Mendelian inheritance, which suggests that this polymorphic minisatellite could be a useful marker for paternity mapping and DNA fingerprinting.
21325284 The activity of CTCF in controlling Rb2/p130 gene expression is impaired by BORIS, which by binding to the Rb2/p130 gene could trigger changes in the chromatin asset established by CTCF affecting CTCF regulatory activity on Rb2/p130 transcription.
21296871 Data show that the BORIS/CTCF mRNA expression ratio is closely associated with DNA hypomethylation and confers poor prognosis in EOC.
21079786 Data suggest that the BORIS gene is involved in a range of functionally important aspects of both normal gametogenesis and cancer development.
21034534 The short rare alleles of BORIS-MS2 could be used to identify the risk for breast cancer in young patients.
21034534 Observational study of gene-disease association. (HuGE Navigator)
20649179 Expression of the cancer-germline (CG) (or cancer-testis) antigen gene BORIS/CTCFL has been proposed to mediate activation of CG antigen genes in cancer.
20438700 the C-terminal fragment of CTCFL predominantly consists of extended and unordered content.
20305816 BORIS (CTCFL) is not expressed in most human breast cell lines and high grade breast carcinomas
19675668 As no mutations were detected at CTCFL in the patients examined, we conclude that genetic alterations of CTCFL are not responsible for the SRS hypomethylation.
19675668 Observational study of gene-disease association. (HuGE Navigator)
18765639 BORIS acts as a platform upon which BAT3 and SET1A assemble and exert effects upon chromatin structure and gene expression.
18632606 CTCFL/BORIS is a methylation-independent DNA-binding protein that preferentially binds to the paternal H19 differentially methylated region
18467432 Differential expression of the cancer/testis gene BORIS in human preimplantation development.
18413740 Chromatin immunoprecipitation analysis of the BAG-1 promoter in DNMT1-overexpressing or DNMT3B-overexpressing colon cells show a permissive chromatin status assoscsiated with DNA binding of BORIS.
18195709 The ability of BORIS to activate promoters of the RP and ER genes points towards possible involvement of BORIS in the establishment, progression and maintenance of breast tumours.
18095639 These data establish promoter DNA hypomethylation as a mechanism leading to BORIS expression in human ovarian cancer.
17962299 Alternative promoter usage generated at least five alternatively spliced BORIS mRNAs with different half-lives determined by varying 5'-UTRs.
17957795 Activation of BORIS is associated with melanoma
17428394 The expression of BORIS antigen is much stronger in breast cancer than that in benign breast disease and normal breast tissues, which indicate that BORIS may be involved in the pathogenesis of the breast cancer.
17363524 we detected a high frequency of BORIS expression in uterine cancers.
17062669 BORIS represents a new class of cancer biomarkers different from those currently used in medical practice.
16854382 The lack of hypomethylation in the CFCFL promoter reinforces evidence that 'genome-wide' hypomethylation is not random.
16140944 Data indicate that reciprocal binding of CTCF and BORIS to the NY-ESO-1 promoter mediates epigenetic regulation of this CT gene in lung cancer cells.

AA Sequence

MAATEISVLSEQFTKIKELELMPEKGLKEEEKDGVCREKDHRSPSELEAERTSGAFQDSVLEEEVELVLA      1 - 70
PSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQ     71 - 140
ELYSPQEMEVLQFHALEENVMVASEDSKLAVSLAETTGLIKLEEEQEKNQLLAERTKEQLFFVETMSGDE    141 - 210
RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHT    211 - 280
SEKPHLCHLCLKTFRTVTLLRNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYA    281 - 350
SVEASKLKRHVRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQK    351 - 420
HGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTHKNEKRFKCKH    421 - 490
CSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDANFIPTVYKCSKCGKGFSRWIN    491 - 560
LHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQKEAAKGWKEAANGDEAAAEEASTTKGEQFPG    561 - 630
EMFPVACRETTARVKEEVDEGVTCEMLLNTMDK                                         631 - 663
//

Text Mined References (56)

PMID Year Title
26185996 2015 Different Effects of BORIS/CTCFL on Stemness Gene Expression, Sphere Formation and Cell Survival in Epithelial Cancer Stem Cells.
26125810 2015 BORIS and CTCF are overexpressed in squamous intraepithelial lesions and cervical cancer.
25499215 2014 Frequent disruption of chromodomain helicase DNA-binding protein 8 (CHD8) and functionally associated chromatin regulators in prostate cancer.
25363021 2014 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
24984200 2014 The epigenetic factor BORIS/CTCFL regulates the NOTCH3 gene expression in cancer cells.
24983365 2014 Circulating cell-free cancer-testis MAGE-A RNA, BORIS RNA, let-7b and miR-202 in the blood of patients with breast cancer and benign breast diseases.
24658009 2014 Hypomethylation of the CTCFL/BORIS promoter and aberrant expression during endometrial cancer progression suggests a role as an Epi-driver gene.
24563233 2014 Possible prognostic value of BORIS transcript variants ratio in laryngeal squamous cell carcinomas - a pilot study.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24279897 2013 BORIS/CTCFL is an RNA-binding protein that associates with polysomes.
24123052 2014 Expression of the cancer-testis antigen BORIS correlates with prostate cancer.
23955684 2013 Lack of association of MTHFR rs1801133 polymorphism and CTCFL mutations with sperm methylation errors in infertile patients.
23553099 2013 The cancer-testis antigen BORIS phenocopies the tumor suppressor CTCF in normal and neoplastic cells.
23390377 2013 BORIS/CTCFL mRNA isoform expression and epigenetic regulation in epithelial ovarian cancer.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23237599 2013 BORIS, brother of the regulator of imprinted sites, is aberrantly expressed in hepatocellular carcinoma.
22792300 2012 Dose-dependent activation of putative oncogene SBSN by BORIS.
22724006 2012 A cell cycle role for the epigenetic factor CTCF-L/BORIS.
22676270 2012 Cancer-testis antigen BORIS is a novel prognostic marker for patients with esophageal cancer.
22223638 2012 Intronic promoter drives the BORIS-regulated expression of FerT in colon carcinoma cells.
22168535 2011 Expression of the epigenetic factor BORIS (CTCFL) in the human genome.
21874228 2011 Genome-wide copy number profiling using a 100K SNP array reveals novel disease-related genes BORIS and TSHZ1 in juvenile angiofibroma.
21811597 2011 Widespread expression of BORIS/CTCFL in normal and cancer cells.
21558405 2011 BORIS binding to the promoters of cancer testis antigens, MAGEA2, MAGEA3, and MAGEA4, is associated with their transcriptional activation in lung cancer.
21495859 2011 Analysis of promoter methylation and polymorphic minisatellites of BORIS and lack of association with gastric cancer.
21325284 2011 CTCF and BORIS regulate Rb2/p130 gene transcription: a novel mechanism and a new paradigm for understanding the biology of lung cancer.
21296871 2011 Coordinated cancer germline antigen promoter and global DNA hypomethylation in ovarian cancer: association with the BORIS/CTCF expression ratio and advanced stage.
21079786 2010 The structural complexity of the human BORIS gene in gametogenesis and cancer.
21034534 2010 Susceptibility for breast cancer in young patients with short rare minisatellite alleles of BORIS.
20649179 2010 BORIS/CTCFL expression is insufficient for cancer-germline antigen gene expression and DNA hypomethylation in ovarian cell lines.
20438700 2010 Molecular architecture of CTCFL.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20305816 2010 BORIS (CTCFL) is not expressed in most human breast cell lines and high grade breast carcinomas.
19675668 2009 No evidence for mutations of CTCFL/BORIS in Silver-Russell syndrome patients with IGF2/H19 imprinting control region 1 hypomethylation.
18765639 2008 BAT3 and SET1A form a complex with CTCFL/BORIS to modulate H3K4 histone dimethylation and gene expression.
18632606 2008 CTCFL/BORIS is a methylation-independent DNA-binding protein that preferentially binds to the paternal H19 differentially methylated region.
18467432 2008 Differential expression of the embryo/cancer gene ECSA(DPPA2), the cancer/testis gene BORIS and the pluripotency structural gene OCT4, in human preimplantation development.
18413740 2008 DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation.
18195709 2008 BORIS, a paralogue of the transcription factor, CTCF, is aberrantly expressed in breast tumours.
18095639 2007 DNA methylation-dependent regulation of BORIS/CTCFL expression in ovarian cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17962299 2007 Expression of the CTCF-paralogous cancer-testis gene, brother of the regulator of imprinted sites (BORIS), is regulated by three alternative promoters modulated by CpG methylation and by CTCF and p53 transcription factors.
17957795 2008 Expression of BORIS in melanoma: lack of association with MAGE-A1 activation.
17428394 2007 [Preparation of the monoclonal antibodies against human BORIS and the expression pattern of BORIS in normal and diseased human mammary tissues].
17363524 2007 Global expression analysis of cancer/testis genes in uterine cancers reveals a high incidence of BORIS expression.
17062669 2006 The potential of BORIS detected in the leukocytes of breast cancer patients as an early marker of tumorigenesis.
17048991 2006 The testis-specific factor CTCFL cooperates with the protein methyltransferase PRMT7 in H19 imprinting control region methylation.
16854382 2006 Epigenetic control of CTCFL/BORIS and OCT4 expression in urogenital malignancies.
16140944 2005 Reciprocal binding of CTCF and BORIS to the NY-ESO-1 promoter coincides with derepression of this cancer-testis gene in lung cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191639 2002 The novel BORIS + CTCF gene family is uniquely involved in the epigenetics of normal biology and cancer.
12011441 2002 BORIS, a novel male germ-line-specific protein associated with epigenetic reprogramming events, shares the same 11-zinc-finger domain with CTCF, the insulator protein involved in reading imprinting marks in the soma.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.