Property Summary

NCBI Gene PubMed Count 187
PubMed Score 656.91
PubTator Score 523.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.858 3.2e-09
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-03
ovarian cancer -1.500 8.1e-08

Gene RIF (153)

PMID Text
27019336 The action of SNF2H at CTCF sites is functionally important as depletion of CTCF or SNF2H affects transcription of a common group of genes.
26938874 CTCF has a role in regulating SLC45A3-ELK4 Chimeric RNA
26929370 CTCF binds to the provirus at a sharp border in epigenetic modifications in the pX region of the HTLV-1 provirus in T cells naturally infected with HTLV-1. This may cause widespread abnormalities in host cell chromatin structure and gene expression.
26833217 Our data show that aberrant epigenetic inactivation of DUSP2 occurs in carcinogenesis and that CTCF is involved in the epigenetic regulation of DUSP2 expression.
26784546 TGF-beta/beta2-spectrin/CTCF-regulated tumor suppression in human stem cell disorder Beckwith-Wiedemann syndrome.
26747525 Mutational analysis highlighted a potential role for CTCF, a crucial regulator of long-range chromatin interactions, in head and neck cancer progression.
26711177 Here, the authors reveal the methylcytosine dioxygenases TET1 and TET2 as active regulators of CTCF-mediated alternative splicing through conversion of 5-methylcytosine to its oxidation derivatives.
26686651 3D genome simulation suggests a model of chromatin folding around chromosomal axes, where CTCF is involved in defining the interface between condensed and open compartments for structural regulation.
26578602 CSB and CTCF can regulate each other's chromatin association, thereby modulating chromatin structure and coordinating gene expression in response to oxidative stress.
26478432 CTCF negatively regulates HOXA10 expression in breast cancer cells.CTCF flanks important promoter element of HOXA10.
26439501 CTCF and cohesins shape the genome during evolution. (Review)
26376810 CTCF/cohesin coordinates HOXA cluster higher-order chromatin structure and expression during development
26330387 data demonstrate there is strong selection for inactivation of both CTCF and ZFHX3 in Endometroid Endometrial cancer(EEC).
26321640 CTCF helps recruit CENP-E to the centromere during mitosis and that it may do so through a structure stabilized by the CTCF/CENP-E complex.
26321255 PARP1- and CTCF-regulate contacts between circadian loci and the repressive chromatin environment at the lamina therefore mediate circadian transcriptional plasticity.
26315019 These results demonstrate the existence of definitive CTCF binding motifs corresponding to CTCF's diverse functions.
26302455 the CTCF-associated boundary element, CBS5, employs both Cohesin and noncoding RNA to establish and maintain topologically associated domains at the HOXA locus.
26276636 Study suggests that genome-wide topological chromatin looping can be predicted based on CTCF/cohesin directional binding; findings reveal how nonlinear 3D genome topology could be encoded by linear 1D genomic sequences.
26154016 CTCF can both enhance and repress virus gene expression. [review]
26125810 Data found that BORIS and CTCF expression in low-grade squamous intraepithelial lesions and invasive cervical carcinoma is higher than in normal samples. The possible utility of BORIS and CTCF as biomarkers in cervical neoplasm requires further analysis.
25936568 CTCF controls the homeostatic maintenance and migration of Langerhans cells.
25934638 a considerable number of alternative splicing events could have a chromatin-dependent regulation involving the association of HP1alpha and CTCF near regulated exons.
25881024 Results provide insights into the distribution of histone modifications at promoters and suggest a novel role of CTCF and cohesin as regulators of transcriptional direction.
25875106 Our findings identify both SMC1 and CTCF as critical regulators of the differentiation-dependent life cycle of high-risk human papillomaviruses
25703332 results provide evidence that CTCF/cohesin-mediated chromatin looping of the PTGS2 locus is dynamically influenced by the DNA methylation status.
25694598 Authors conclude that high-risk human papillomavirus types have evolved to recruit CTCF to the early gene region to control the balance and complexity of splicing events that regulate viral oncoprotein expression.
25658338 To validate this finding and to better understand the phenomenon, we used LNCaP, a prostate cell line as a model, and identified 16 additional cis-SAGe events by silencing transcription factor CTCF and paired-end RNA sequencing.
25592173 A novel single nucleotide polymorphism rs60507107 was significantly associated with increased risk of lung cancer in two stages
25580597 These elements are highly occupied by the insulator protein CTCF, are DNase I hypersensitive and represent only a small minority of the CTCF recognition sequences in the human genome
25499215 In the first detailed analysis in cancer, a marked loss of CHD8 expression and increased BORIS/CTCF ratio indicate frequent disruption of CTCF and its effector genes in PCa.
25411781 our data reveal extensive genetic effects on CTCF binding, both direct and indirect, and identify a diversity of patterns of CTCF binding on the X chromosome.
25299688 Studied the role of looping in large-scale (supra Mb) folding of human chromosomes by knocking down the gene that codes for CTCF and the one coding for Rad21, an essential subunit of cohesin.
25135475 CTCF facilitates the stabilization of Polycomb repressive complex 2 and trimethylated lysine 27 of histone H3 at the human HOXA locus.
24901509 In the gene-based analysis, CACNB2 and CTCF showed the strongest evidence for association with schizophrenia in both the present samples and in those of the Psychiatric Genetics Consortium datasets.
24842653 The methylation status of CTCF and SIRT6 promoter regions was not statistically different in cancer lesions compared with matched normal tissues.
24794443 Findings establish CTCF as a prominent tumor-suppressor gene and point to CTCF-mediated epigenetic stability as a major barrier to neoplastic progression.
24725430 results reveal the functional relevance of vigilin and CTCF, and show that the CTCF-vigilin complex contributes to regulation of Igf2/H19
24659782 Data show that the transcription of angiogenin (ANG) and ribonuclease 4 (RNASE4) promoter is influenced by RNA polymerase III (Pol III) elements and could be differentially regulated by an intragenic CCCTC binding factor (CTCF)-dependent chromatin loop.
24614316 CTCF links the architecture of the genome to its function. [Review]
24561205 CTCF may regulate vigilin behavior and thus indirectly influence the binding of HP1alpha to the satellite 2 locus
24534946 Our results demonstrated an aberrant methylation pattern at a CTCF binding site downstream the WT1 gene, which is associated with an elevated WT1 transcriptional activity
24498324 Data show that CCCTC-binding factor (CTCF) together with ISWI ATPase SMARCA5 and members of the Cohesin complex associate with the SPI1 protein is disrupted in acute myeloid leukemia (AML) blasts.
24415941 CTCF and Rad21 act as host cell restriction factors for Kaposi's sarcoma-associated herpesvirus (KSHV) lytic replication by modulating viral gene transcription.
24393203 CTCF may play a significant role in the anti-apoptotic pathway mediated by NF-kappaB in pediatric Acute lymphoblastic leukemia
24362533 This work demonstrates that, in contexts in which BCL6 is expressed, CTCF binding to BCL6 exon1A associates with epigenetic modifications indicative of transcriptionally open chromatin.
24335803 CTCF and cohesin contribute differentially to chromatin organization and gene regulation
24321385 The intronic binding sites for cohesin and CTCF coincide with histone modifications that confer enhancer-like properties, and two of the cohesin/CTCF sites behaved as insulators in an in vivo assay.
24257606 A single CTCF binding site controls LMP2A and LMP1 promoter selection, chromatin boundary function and episome copy number control during Epstein-Barr virus latency.
24174344 Results show that CCCTC-binding factor (CTCF) plays an important role in maintaining telomerase reverse transcriptase catalytic subunit (TERT) expression in a subset of lung cancer cell lines may be due to CTCF-dependent enhancer-promoter interactions.
24130125 Data shows that T204fs, a frameshift mutation in CTCF gene is frequent in endometrial neoplasms with microsatellite istability. Also, The spectrum and pattern of mutations observed is consistent with CTCF acting as a haploinsufficient tumor suppressor.
24023969 Increased DNA methylation at the FXN upstream GAA region, primarily 5 hmC rather than 5 mC, and decreased CTCF occupancy at the FXN 5' UTR are associated with FRDA disease-relevant human tissues.
23908591 Data show that CCCTC binding factor (CTCF) binding was enriched at the Bax CTCF binding sites (CTSs) in breast cancer cells and tumors.
23884423 condensin competes with CTCF in binding to a specific rDNA locus and negatively regulates CTCF-mediated rRNA gene transcription.
23874213 FXS cells and its splicing is correlated to that of the FMR1-mRNA. We conclude that CTCF has a complex role in regulating FMR1 expression, probably through the organization of chromatin loops between sense/antisense transcriptional regulatory regions
23843455 a direct regulatory relationship between EGF-induced NFkappaB p50 and CTCF activation affecting corneal epithelial wound healing has been established
23746550 Haploinsufficiency of CTCF affects genomic interaction of enhancers and their regulated gene promoters that drive developmental processes and cognition.
23706817 Studies suggest that CTCF binding sites exhibited barrier insulator function.
23620300 CTCF regulates the expression of IPO13, which, in turn, mediates the nuclear import of CTCF.
23553099 CTCF and BORIS suppressed breast cancer growth; findings provide further evidence that CTCF behaves as a tumor suppressor, and show BORIS has a similar growth inhibitory effect in vitro and in vivo
23204437 CTCF/cohesin-mediated DNA looping is required for protocadherin alpha promoter choice
23192870 CTCF binding sites regulate mRNA production, RNA polymerase II (RNAPII) programming, and nucleosome organization of the Kaposi's sarcoma-associated herpesvirus latency transcript control region.
23186133 Results found that CTCF may be bound immediately upstream of RNA polymerase II in most active CpG island promoters.
22952237 This partnership between CTCF and cohesin is emerging as a novel and perhaps pivotal aspect of gene regulatory mechanisms, in addition to playing a role in the organization of higher order chromatin architecture
22944692 Positional proteomics analysis identifies the cleavage of human CCCTC-binding factor (zinc finger protein) (CTCF) at amino acid residues 360-361 by the HIV-1 protease
22879976 The role of CTCF in human embryonic stem cell (hESC) biology, was examined.
22791747 The macrosatellite DXZ4 mediates CTCF-dependent long-range intrachromosomal interactions on the human inactive X chromosome
22615834 Knocking-down CTCF expression hampered RARRES1 expression.
22538856 Loss of CTCF-mediated restriction of enhancer activity may well contribute to oncogenic activation, when in chromosomal translocations Ig enhancer elements and oncogenes appear in a novel genomic context.
22487828 CTCF is involved in multiple aspects of epigenetic regulation.
22422629 Results showed that CTCF, A-type lamins and an active HDAC were essential for perinuclear positioning of CFTR and these components acted on a CTCF site adjacent to the CFTR promoter.
22354964 Hypoxic stress induces de-SUMOylation of CTCF to functionally regulate CTCF activity.
22347474 characterized the cell-type specific spatial organization of the kcnq5 gene locus mediated by CTCF in detail using chromosome conformation capture (3C) and 3C-derived techniques
22286186 Data suggest that CTCF contributes to the structural organization of the nucleolus and, through epigenetic mechanisms, to the regulation of the ribosomal gene expression.
22247490 CTCF, an epigenetic regulator and transcription factor, involves EGF-induced increases in cell motility and migration.
22142239 CTCF binding can co-localise with ER and/or FOXA1 in MCF-7 cells.
22072770 CTCF contributes to but is not essential for the establishment of restricted latency.
21970734 recent advances in CTCF biology and discussion of the role of histone variants H2A.Z and H3.3 at CTCF binding sites [review]
21964334 a DNA-binding protein, CCCTC-binding factor (CTCF), can promote inclusion of weak upstream exons by mediating local RNA polymerase II pausing both in a mammalian model system for alternative splicing, CD45, and genome-wide
21912613 a novel mechanism for regulatory control of CTCF in UV stress-induced human corneal epithelial cells, which requires activation and formation of Bcl-3/p50 complex through a noncanonical NF-kappaB pathway
21663659 CTCF plays an important role in maintaining the Rb promoter in an optimal chromatin configuration. Its absence induces rapid epigenetic silencing through progressive gain of DNA methylation.
21550623 Human CTCF binds specific sites throughout the latent EBV genome. CTCF colocalizes with cohesin but not RNAP II. The overlapping cohesin-binding sites are found proximal to regulatory elements of both latent and lytic genes.
21536749 CTCF epigenetically governs allelic gene expression of IGF2 by orchestrating chromatin loop structures involving PRC2
21444719 results demonstrate specific sites on C terminus of CTCF are essential for cohesin binding and insulator function; only direct interaction between CTCF and cohesin involves contact with SA2, which is external to the cohesin ring
21325284 The activity of CTCF in controlling Rb2/p130 gene expression is impaired by BORIS, which by binding to the Rb2/p130 gene could trigger changes in the chromatin asset established by CTCF affecting CTCF regulatory activity on Rb2/p130 transcription.
21296871 Data show that the BORIS/CTCF mRNA expression ratio is closely associated with DNA hypomethylation and confers poor prognosis in EOC.
20966046 DEAD-box RNA helicase p68 (DDX5) and its associated noncoding RNA, steroid receptor RNA activator (SRA), form a complex with CTCF that is essential for insulator function
20877461 CTCF bound to insulator sequences located between BLU and RASSF1A.
20733034 BCL6 expression is maintained during lymphomagenesis in part through DNA methylation that prevents CTCF-mediated silencing.
20610384 CCCTC-binding factor acts upstream of FOXA1 and demarcates the genomic response to estrogen.
20584980 CTCF organizes the MHC-II locus into a novel basal architecture of interacting foci and loop structures that rearranges in the presence of CIITA.
20478995 CTCF plays a pivotal role in dampening the p53 apoptotic response by acting as a gene-specific repressor
20404925 determine whether CTCF and TR combined sites are representative of a general feature of the genome, and whether such sites are functional in regulating enhancer blocking
20196073 Recombinant terminal fragments of human CCCTC-binding factor were purified and observed that both are extended, monomeric, and predominantly consist of unordered content.
20133600 These results support a genome-wide role for CTCF/cohesin sites through loop formation that both influences transcription and contributes to cell-type-specific chromatin organization and function.
20110362 CTCF is a downstream component of the NF-kappaB pathway involved in the core transcriptional network of cell fate
20101205 CTCF protects the p53 gene promoter against repressive histone marks.
20051228 CTCF is an essential factor for transcription of the INK/ARF locus and abrogation of its binding by DNA methylation contributes to the permanent silencing of several genes of the locus in tumors.
20038529 model of CTCF regulation by poly(ADP-ribosyl)ation whereby CTCF and PARP-1 form functional complexes at sites along the DNA, producing a dynamic reversible modification of CTCF
19956589 there is a a severe depletion of CTCF in the 5'UTR of the FXN gene in FRDA, and coincident heterochromatin formation involving the +1 nucleosome via enrichment of H3K9me3 and recruitment of heterochromatin protein 1
19922652 analysis of key differences among CTCF occupancy-based classes
19818655 cooperation between architectural (CTCF) and transcriptional enhancing (T-bet) factors and the elements to which they bind is required for proper Th1 cell-specific expression of Ifng.
19737964 The loss of CTCF poly(ADP-ribosyl)ation is associated with cell proliferation and breast tumor development.
19644448 These findings reveal the existence of an 80 bp D4Z4 human subtelomeric repeat sequence that is sufficient to position an adjacent telomere to the nuclear periphery in a CTCF and A-type lamins-dependent manner.
19584098 Results show that spermatozoa endonuclease sensitivity DNA sequences are closely associated with gene regulatory regions, including many promoter sequences and sequences recognized by CCCTC-binding factor (CTCF).
19568426 findings collectively demonstrate that CTCF-binding at the human MYC locus does not repress transcriptional activity but is required for protection from DNA methylation
19513555 Report aberrant epigenetic modifications in the CTCF binding domain of the IGF2/H19 gene in prostate cancer compared with benign prostate hyperplasia.
19450526 Results substantiate the critical role of CTCF in establishing and maintaining p16INK4A and other tumor suppressor genes in higher-order chromosomal domains through appropriate boundary formation.
19369356 Deletion of CTCF binding sites altered the normal cell cycle control of transcription for KSHV latency-associated genes.
19322193 CTCF/cohesin-mediated insulators maintain the chromatin loop formation and the localization of transcriptional apparatus at the promoters.
19247430 Regulation of the D4Z4 array depends on both the number of repeats and the presence of CTCF and A-type Lamins in facio-scapulo-humeral dystrophy.
19158269 These data argue that the regulation of the IL-3 and the GM-CSF promoters depends on the positions of their enhancers relative to the conserved CTCF/cohesin-binding sites.
19074263 intrinsic looping activity of CTCF sites can nullify locus control region function.
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19056695 mapped the genome-wide binding sites of CTCF in three cell types and identified significant binding of CTCF to the boundaries of repressive chromatin domains marked by H3K27me3
19008940 CTCF binding-site mutation promotes triplet repeat instability both in the germ line and in somatic tissues.
18923423 CTCF is required in a dose-dependent manner and is involved in cell cycle progression of alphabeta T cells in the thymus.
18654629 CTCF positions 20 nucleosomes around its binding sites across the human genome.
18604514 Results decribethe loss IGF2/H19 imprinting,loss of heterozygosity of IGF2R and CTCF, and incidental H. pylori infections in laryngeal squamous cell carcinoma.
18550811 STAG1 (Scc3/SA1) subunit of cohesin interacts with the CCTC-binding factor CTCF bound to the c-myc insulator element.
18347100 The results suggest a model whereby both HLA-DRB1 and HLA-DQA1 loci can interact simultaneously with XL9, and describe a regulatory mechanism involving the alteration of the general chromatin conformation and their regulation by CTCF.
18237772 Study shows that the distribution of cohesins on mammalian chromosome arms is not driven by transcriptional activity, instead, cohesins are found at most CTCF sites and CTCF is required for cohesin localization to these sites.
18235444 description of cohesin-binding sites in the human genome; most of these are associated with the CCCTC-binding factor (CTCF), a zinc-finger protein required for transcriptional insulation
18207574 Band-shift analysis upon the nuclear fractions from HIV-1 resistant cells showed that CTCF protein bound to HIV-1 promoter and this binding prevented the formation of NF-kappaB/LTR complex.
18021171 CTCF is indeed a protein with multifunctional activity that plays a significant role in modulating signalling pathways to mediate insulin-induced ML-1 cell proliferation.
17827499 a small number of zinc fingers mediate strong binding of CTCF to DNA, and a single finger-DNA interaction controls binding at imprinted loci
17583694 Results reveal that CTCF is a down stream target of stress-induced signaling cascades and it plays a significant anti-apoptotic role in regulation of stress-induced cellular responses in HCE and hematopoietic myeloid cells.
17382889 Study describes 13,804 CTCF-binding sites in potential insulators of the human genome in primary human fibroblasts; most of these sequences are located far from the transcriptional start sites, with their distribution strongly correlated with genes
17267480 this study reports the identification and characterization of an insulator from the herpes simplex virus-1 LAT intron region that functions via CTCF
16989720 CTCF is a multifunctional epigenetic regulator with a role in carcinogenesis (review)
16731911 increased CTCF can repress EBNA2 transcription
16230345 the Kaiso-CTCF interaction negatively regulates CTCF insulator activity
16140944 Data indicate that reciprocal binding of CTCF and BORIS to the NY-ESO-1 promoter mediates epigenetic regulation of this CT gene in lung cancer cells.
16107875 chromatin loop organized by the CTCF-bound, differentially methylated region at the Igf2/H19 locus can be detected in mitosis
15958555 CTCF overexpression may have evolved as a compensatory mechanism to protect breast cancer cells from apoptosis, thus providing selective survival advantages to these cells.
15941718 CTCF is involved in the control of myeloid cell growth and differentiation
15731119 point mutations in the XIST promoter reveal a correlation between CTCF binding and pre-emptive choices of X chromosome inactivation
15670593 CTCF plays a major role in IRAK2 transcription; EMSA revealed a CTCF-binding site within the mouse Irak2 promoter
15471867 novel mechanism for IGF2 imprinting regulation, that is, the reduction of CTCF expression in the control of IGF2 imprinting
15304340 The terminal domain is active in HeLa, HEK293 and COS-7 cell lines where it is both sufficient and necessary for silencing an SV40 core promoter.
15096508 CTCF regulates Pax6 transcription by binding to its repressor element, which in turn blocks the effect of the ectoderm enhancer resulting in the inhibition of P0 promoter activity.
15084242 Observational study of gene-disease association. (HuGE Navigator)
14759373 CTCF has a role in tethering an insulator to subnuclear sites
14645507 beta-globin locus control region HS5 contains enhancer-blocking (insulator) activity that is both CTCF and developmental stage dependent
14503807 CTCF can be inactivated by somatic mutation and genetic or epigenetic silencing of the wild-type allele in individual cases of invasivene ductal breast cancer; loss of CTCF protein function may contribute to tumor heterogeneity
12960026 CTCF binding at the human IGF2/H19 imprinting control region(ICR). CTCF binding at the IGF2/H19 ICR is insufficient to regulate expression of IGF2/H19 in many human tissues.
12878173 the insulator activity of CTCF apparently involves an HDAC-independent association with the nuclear matrix
12524457 CTCF is a common determinant to different pathways of death signaling in immature B cells.
12203779 Loss of CTCF mRNA or protein in Wilms tumors does not predispose to de novo methylation of the maternal allele of H19 but leaves open the possibility that post-transcriptional loss of CTCF protein may account for some instances of loss of imprinting.
12099698 Transforming growth factor-beta-induced transcription of the Alzheimer beta-amyloid precursor protein gene involves interaction between the CTCF-complex and Smads
11997516 Conserved CTCF insulator elements flank the mouse and human beta-globin loci.
11971967 Insertional mutagenesis identified nucleosome positioning sequences (NPSs) allow the remarkably precise distribution of target sites for the chromatin insulator protein CTCF to nucleosome linker sequences in the H19 ICR.
11782357 observations suggest that CTCF may represent a novel tumor suppressor gene that displays tumor-specific "change of function" rather than complete "loss of function"
11743158 It's proposed that Tsix and CTCF together establish a regulatable epigenetic switch for X-inactivation.

AA Sequence

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTL      1 - 70
LQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYEN     71 - 140
EVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKS    141 - 210
KLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSN    211 - 280
LDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKP    281 - 350
FKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG    351 - 420
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHK    421 - 490
NEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKC    491 - 560
GKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAV    561 - 630
EIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGE    631 - 700
EEEAQPAATDAPNGDLTPEMILSMMDR                                               701 - 727
//

Text Mined References (196)

PMID Year Title
27019336 2016 The Chromatin Remodelling Enzymes SNF2H and SNF2L Position Nucleosomes adjacent to CTCF and Other Transcription Factors.
26938874 2016 Role of CTCF in Regulating SLC45A3-ELK4 Chimeric RNA.
26929370 2016 The retrovirus HTLV-1 inserts an ectopic CTCF-binding site into the human genome.
26833217 2016 The dual specificity phosphatase 2 gene is hypermethylated in human cancer and regulated by epigenetic mechanisms.
26784546 2016 TGF-?/?2-spectrin/CTCF-regulated tumor suppression in human stem cell disorder Beckwith-Wiedemann syndrome.
26747525 2016 IL-10 and integrin signaling pathways are associated with head and neck cancer progression.
26711177 2016 TET-catalyzed oxidation of intragenic 5-methylcytosine regulates CTCF-dependent alternative splicing.
26686651 2015 CTCF-Mediated Human 3D Genome Architecture Reveals Chromatin Topology for Transcription.
26578602 2016 The CSB chromatin remodeler and CTCF architectural protein cooperate in response to oxidative stress.
26478432 2015 CTCF negatively regulates HOXA10 expression in breast cancer cells.
26439501 2015 Genetic Tailors: CTCF and Cohesin Shape the Genome During Evolution.
26376810 2015 Exploring CTCF and cohesin related chromatin architecture at HOXA gene cluster in primary human fibroblasts.
26330387 2015 Patterns of CTCF and ZFHX3 Mutation and Associated Outcomes in Endometrial Cancer.
26321640 2015 CTCF Recruits Centromeric Protein CENP-E to the Pericentromeric/Centromeric Regions of Chromosomes through Unusual CTCF-Binding Sites.
26321255 2015 PARP1- and CTCF-Mediated Interactions between Active and Repressed Chromatin at the Lamina Promote Oscillating Transcription.
26315019 2015 Functional diversity of CTCFs is encoded in their binding motifs.
26302455 2015 Boundary Associated Long Noncoding RNA Mediates Long-Range Chromosomal Interactions.
26276636 2015 CRISPR Inversion of CTCF Sites Alters Genome Topology and Enhancer/Promoter Function.
26154016 2015 Targeting CTCF to Control Virus Gene Expression: A Common Theme amongst Diverse DNA Viruses.
26125810 2015 BORIS and CTCF are overexpressed in squamous intraepithelial lesions and cervical cancer.
25936568 2015 CCCTC-binding factor controls the homeostatic maintenance and migration of Langerhans cells.
25934638 2015 A chromatin code for alternative splicing involving a putative association between CTCF and HP1? proteins.
25881024 2015 Different distribution of histone modifications in genes with unidirectional and bidirectional transcription and a role of CTCF and cohesin in directing transcription.
25875106 2015 Human papillomaviruses activate and recruit SMC1 cohesin proteins for the differentiation-dependent life cycle through association with CTCF insulators.
25703332 2015 Disruption of CTCF/cohesin-mediated high-order chromatin structures by DNA methylation downregulates PTGS2 expression.
25694598 2015 CCCTC-binding factor recruitment to the early region of the human papillomavirus 18 genome regulates viral oncogene expression.
25658338 2015 Discovery of CTCF-sensitive Cis-spliced fusion RNAs between adjacent genes in human prostate cells.
25646466 2015 Genome-wide targeting of the epigenetic regulatory protein CTCF to gene promoters by the transcription factor TFII-I.
25592173 2015 Systematical analyses of variants in CTCF-binding sites identified a novel lung cancer susceptibility locus among Chinese population.
25580597 2015 Genomic discovery of potent chromatin insulators for human gene therapy.
25499215 2014 Frequent disruption of chromodomain helicase DNA-binding protein 8 (CHD8) and functionally associated chromatin regulators in prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25411781 2014 Quantitative genetics of CTCF binding reveal local sequence effects and different modes of X-chromosome association.
25299688 2014 Depletion of the chromatin looping proteins CTCF and cohesin causes chromatin compaction: insight into chromatin folding by polymer modelling.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25135475 2014 CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.
24937458 2014 JARID1B is a luminal lineage-driving oncogene in breast cancer.
24901509 2014 Integrated pathway-based approach identifies association between genomic regions at CTCF and CACNB2 and schizophrenia.
24842653 2014 The promoter methylation status and mRNA expression levels of CTCF and SIRT6 in sporadic breast cancer.
24794443 2014 CTCF haploinsufficiency destabilizes DNA methylation and predisposes to cancer.
24725430 2014 Vigilin interacts with CCCTC-binding factor (CTCF) and is involved in CTCF-dependent regulation of the imprinted genes Igf2 and H19.
24659782 2014 Transcription of angiogenin and ribonuclease 4 is regulated by RNA polymerase III elements and a CCCTC binding factor (CTCF)-dependent intragenic chromatin loop.
24614316 2014 CTCF: an architectural protein bridging genome topology and function.
24561205 2014 CTCF-mediated reduction of vigilin binding affects the binding of HP1? to the satellite 2 locus.
24534946 2014 Frequent hypermethylation of a CTCF binding site influences Wilms tumor 1 expression in Wilms tumors.
24498324 2014 Epigenetic control of SPI1 gene by CTCF and ISWI ATPase SMARCA5.
24415941 2014 CTCF and Rad21 act as host cell restriction factors for Kaposi's sarcoma-associated herpesvirus (KSHV) lytic replication by modulating viral gene transcription.
24393203 2014 NF-kappa B mediated up-regulation of CCCTC-binding factor in pediatric acute lymphoblastic leukemia.
24362533 2015 Novel CTCF binding at a site in exon1A of BCL6 is associated with active histone marks and a transcriptionally active locus.
24335803 2014 Cohesin and CTCF differentially affect chromatin architecture and gene expression in human cells.
24321385 2014 Cohesin and CTCF differentially regulate spatiotemporal runx1 expression during zebrafish development.
24257606 2014 Epigenetic deregulation of the LMP1/LMP2 locus of Epstein-Barr virus by mutation of a single CTCF-cohesin binding site.
24174344 2014 CTCF mediates the TERT enhancer-promoter interactions in lung cancer cells: identification of a novel enhancer region involved in the regulation of TERT gene.
24130125 2014 High frequency strand slippage mutations in CTCF in MSI-positive endometrial cancers.
24023969 2013 Friedreich ataxia patient tissues exhibit increased 5-hydroxymethylcytosine modification and decreased CTCF binding at the FXN locus.
23908591 2013 A novel mechanism for CTCF in the epigenetic regulation of Bax in breast cancer cells.
23884423 2013 Ribosomal RNA gene transcription mediated by the master genome regulator protein CCCTC-binding factor (CTCF) is negatively regulated by the condensin complex.
23874213 2013 Role of CTCF protein in regulating FMR1 locus transcription.
23843455 2013 Epidermal growth factor (EGF)-induced corneal epithelial wound healing through nuclear factor ?B subtype-regulated CCCTC binding factor (CTCF) activation.
23746550 2013 De novo mutations in the genome organizer CTCF cause intellectual disability.
23706817 2013 Chromatin insulators: linking genome organization to cellular function.
23620300 2013 CCCTC-binding factor controls its own nuclear transport via regulating the expression of importin 13.
23553099 2013 The cancer-testis antigen BORIS phenocopies the tumor suppressor CTCF in normal and neoplastic cells.
23204437 2012 CTCF/cohesin-mediated DNA looping is required for protocadherin ? promoter choice.
23192870 2013 CTCF regulates Kaposi's sarcoma-associated herpesvirus latency transcription by nucleosome displacement and RNA polymerase programming.
23186133 2012 Human genes with CpG island promoters have a distinct transcription-associated chromatin organization.
22952237 2012 Genome-wide studies of CCCTC-binding factor (CTCF) and cohesin provide insight into chromatin structure and regulation.
22879976 2012 Functional and molecular characterization of the role of CTCF in human embryonic stem cell biology.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791747 2012 The macrosatellite DXZ4 mediates CTCF-dependent long-range intrachromosomal interactions on the human inactive X chromosome.
22615834 2012 Epigenetic repression of RARRES1 is mediated by methylation of a proximal promoter and a loss of CTCF binding.
22538856 2012 DNA-binding factor CTCF and long-range gene interactions in V(D)J recombination and oncogene activation.
22487828 2012 [A versatile role of transcription regulator CTCF in epigenetics and diseases].
22422629 2012 Perinuclear positioning of the inactive human cystic fibrosis gene depends on CTCF, A-type lamins and an active histone deacetylase.
22354964 2012 De-SUMOylation of CCCTC binding factor (CTCF) in hypoxic stress-induced human corneal epithelial cells.
22347474 2012 CTCF mediates the cell-type specific spatial organization of the Kcnq5 locus and the local gene regulation.
22286186 2012 Changes of the nucleolus architecture in absence of the nuclear factor CTCF.
22247490 2012 Role of CTCF in EGF-induced migration of immortalized human corneal epithelial cells.
22142239 2011 A co-ordinated interaction between CTCF and ER in breast cancer cells.
22072770 2012 Contributions of CTCF and DNA methyltransferases DNMT1 and DNMT3B to Epstein-Barr virus restricted latency.
21970734 2011 CTCF, cohesin, and histone variants: connecting the genome.
21964334 2011 CTCF-promoted RNA polymerase II pausing links DNA methylation to splicing.
21912613 2011 Activation of oxidative stress-regulated Bcl-3 suppresses CTCF in corneal epithelial cells.
21663659 2011 Gain of DNA methylation is enhanced in the absence of CTCF at the human retinoblastoma gene promoter.
21550623 2011 Occupancy of chromatin organizers in the Epstein-Barr virus genome.
21536749 2011 Interruption of intrachromosomal looping by CCCTC binding factor decoy proteins abrogates genomic imprinting of human insulin-like growth factor II.
21444719 2011 Specific sites in the C terminus of CTCF interact with the SA2 subunit of the cohesin complex and are required for cohesin-dependent insulation activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21325284 2011 CTCF and BORIS regulate Rb2/p130 gene transcription: a novel mechanism and a new paradigm for understanding the biology of lung cancer.
21296871 2011 Coordinated cancer germline antigen promoter and global DNA hypomethylation in ovarian cancer: association with the BORIS/CTCF expression ratio and advanced stage.
21269460 2011 Initial characterization of the human central proteome.
20966046 2010 Mediation of CTCF transcriptional insulation by DEAD-box RNA-binding protein p68 and steroid receptor RNA activator SRA.
20877461 2010 Distinct epigenetic domains separated by a CTCF bound insulator between the tandem genes, BLU and RASSF1A.
20733034 2010 DNA methylation prevents CTCF-mediated silencing of the oncogene BCL6 in B cell lymphomas.
20610384 2010 CCCTC-binding factor acts upstream of FOXA1 and demarcates the genomic response to estrogen.
20584980 2010 CTCF controls expression and chromatin architecture of the human major histocompatibility complex class II locus.
20478995 2010 Gene-specific repression of the p53 target gene PUMA via intragenic CTCF-Cohesin binding.
20404925 2010 Modular insulators: genome wide search for composite CTCF/thyroid hormone receptor binding sites.
20196073 2010 CTCF terminal segments are unstructured.
20133600 2010 Cell type specificity of chromatin organization mediated by CTCF and cohesin.
20110362 2010 NF-kappaB subtypes regulate CCCTC binding factor affecting corneal epithelial cell fate.
20101205 2010 Epigenetic regulation of the human p53 gene promoter by the CTCF transcription factor in transformed cell lines.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20051228 2010 CTCF is a DNA methylation-sensitive positive regulator of the INK/ARF locus.
20038529 2010 Mutational analysis of the poly(ADP-ribosyl)ation sites of the transcription factor CTCF provides an insight into the mechanism of its regulation by poly(ADP-ribosyl)ation.
19956589 2009 Epigenetic silencing in Friedreich ataxia is associated with depletion of CTCF (CCCTC-binding factor) and antisense transcription.
19922652 2009 CTCF binding site classes exhibit distinct evolutionary, genomic, epigenomic and transcriptomic features.
19818655 2009 CCCTC-binding factor and the transcription factor T-bet orchestrate T helper 1 cell-specific structure and function at the interferon-gamma locus.
19737964 2009 Decreased poly(ADP-ribosyl)ation of CTCF, a transcription factor, is associated with breast cancer phenotype and cell proliferation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19644448 2009 Identification of a perinuclear positioning element in human subtelomeres that requires A-type lamins and CTCF.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19584098 2009 Endonuclease-sensitive regions of human spermatozoal chromatin are highly enriched in promoter and CTCF binding sequences.
19568426 2009 Targeted deletion of multiple CTCF-binding elements in the human C-MYC gene reveals a requirement for CTCF in C-MYC expression.
19513555 2009 Aberrant epigenetic modifications in the CTCF binding domain of the IGF2/H19 gene in prostate cancer compared with benign prostate hyperplasia.
19505873 2009 Complementary quantitative proteomics reveals that transcription factor AP-4 mediates E-box-dependent complex formation for transcriptional repression of HDM2.
19450526 2009 Epigenetic silencing of the p16(INK4a) tumor suppressor is associated with loss of CTCF binding and a chromatin boundary.
19369356 2009 Cell cycle control of Kaposi's sarcoma-associated herpesvirus latency transcription by CTCF-cohesin interactions.
19322193 2009 Architectural roles of multiple chromatin insulators at the human apolipoprotein gene cluster.
19247430 2009 The D4Z4 macrosatellite repeat acts as a CTCF and A-type lamins-dependent insulator in facio-scapulo-humeral dystrophy.
19158269 2009 A conserved insulator that recruits CTCF and cohesin exists between the closely related but divergently regulated interleukin-3 and granulocyte-macrophage colony-stimulating factor genes.
19074263 2008 CTCF-dependent enhancer-blocking by alternative chromatin loop formation.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19056695 2009 Global analysis of the insulator binding protein CTCF in chromatin barrier regions reveals demarcation of active and repressive domains.
19008940 2008 CTCF cis-regulates trinucleotide repeat instability in an epigenetic manner: a novel basis for mutational hot spot determination.
18923423 2008 CTCF regulates cell cycle progression of alphabeta T cells in the thymus.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18654629 2008 The insulator binding protein CTCF positions 20 nucleosomes around its binding sites across the human genome.
18604514 2008 Loss of imprinting of IGF2 and H19, loss of heterozygosity of IGF2R and CTCF, and Helicobacter pylori infection in laryngeal squamous cell carcinoma.
18550811 2008 CTCF physically links cohesin to chromatin.
18413740 2008 DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation.
18347100 2008 The insulator factor CTCF controls MHC class II gene expression and is required for the formation of long-distance chromatin interactions.
18237772 2008 Cohesins functionally associate with CTCF on mammalian chromosome arms.
18235444 2008 Cohesin mediates transcriptional insulation by CCCTC-binding factor.
18207574 2008 The critical role of human transcriptional repressor CTCF mRNA up-regulation in the induction of anti-HIV-1 responses in CD4(+) T cells.
18021171 2007 Functional role of CCCTC binding factor in insulin-stimulated cell proliferation.
17827499 2007 Critical DNA binding interactions of the insulator protein CTCF: a small number of zinc fingers mediate strong binding, and a single finger-DNA interaction controls binding at imprinted loci.
17583694 2007 Functional role of CCCTC binding factor (CTCF) in stress-induced apoptosis.
17382889 2007 Analysis of the vertebrate insulator protein CTCF-binding sites in the human genome.
17267480 2007 CTCF-dependent chromatin boundary element between the latency-associated transcript and ICP0 promoters in the herpes simplex virus type 1 genome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16989720 Epigenetic boundaries of tumour suppressor gene promoters: the CTCF connection and its role in carcinogenesis.
16949368 2006 CTCF-dependent chromatin insulator is linked to epigenetic remodeling.
16815976 2006 CTCF binding at the H19 imprinting control region mediates maternally inherited higher-order chromatin conformation to restrict enhancer access to Igf2.
16731911 2006 Regulation of Epstein-Barr virus latency type by the chromatin boundary factor CTCF.
16595548 2006 Targeting of CTCF to the nucleolus inhibits nucleolar transcription through a poly(ADP-ribosyl)ation-dependent mechanism.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230345 2005 The human enhancer blocker CTC-binding factor interacts with the transcription factor Kaiso.
16140944 2005 Reciprocal binding of CTCF and BORIS to the NY-ESO-1 promoter coincides with derepression of this cancer-testis gene in lung cancer cells.
16107875 2005 CTCF binding and higher order chromatin structure of the H19 locus are maintained in mitotic chromatin.
15958555 2005 Heightened expression of CTCF in breast cancer cells is associated with resistance to apoptosis.
15941718 2005 CTCF regulates growth and erythroid differentiation of human myeloid leukemia cells.
15731119 2005 Familial cases of point mutations in the XIST promoter reveal a correlation between CTCF binding and pre-emptive choices of X chromosome inactivation.
15670593 2005 Transcriptional regulator CTCF controls human interleukin 1 receptor-associated kinase 2 promoter.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471867 2004 A loss of insulin-like growth factor-2 imprinting is modulated by CCCTC-binding factor down-regulation at senescence in human epithelial cells.
15454938 2004 Shifting insulator boundaries.
15361875 2004 Poly(ADP-ribosyl)ation regulates CTCF-dependent chromatin insulation.
15304340 2004 A short autonomous repression motif is located within the N-terminal domain of CTCF.
15096508 2004 Regulation of eye development by transcription control of CCCTC binding factor (CTCF).
15084242 2004 A screen for germline mutations in the gene encoding CCCTC-binding factor (CTCF) in familial non-BRCA1/BRCA2 breast cancer.
14759373 2004 CTCF tethers an insulator to subnuclear sites, suggesting shared insulator mechanisms across species.
14716017 2004 Transgenic RNAi reveals essential function for CTCF in H19 gene imprinting.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645543 2003 The c-myc insulator element and matrix attachment regions define the c-myc chromosomal domain.
14645507 2003 Human beta-globin locus control region HS5 contains CTCF- and developmental stage-dependent enhancer-blocking activity in erythroid cells.
14503807 2003 CTCF gene mutations in invasive ductal breast cancer.
12960026 2003 CTCF binding at the insulin-like growth factor-II (IGF2)/H19 imprinting control region is insufficient to regulate IGF2/H19 expression in human tissues.
12878173 2003 The insulator binding protein CTCF associates with the nuclear matrix.
12787766 2003 Genomic insulators: connecting properties to mechanism.
12524457 2003 CTCF functions as a critical regulator of cell-cycle arrest and death after ligation of the B cell receptor on immature B cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461525 2003 CTCF maintains differential methylation at the Igf2/H19 locus.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
12203779 2002 Chromosome arm 16q in Wilms tumors: unbalanced chromosomal translocations, loss of heterozygosity, and assessment of the CTCF gene.
12191639 2002 The novel BORIS + CTCF gene family is uniquely involved in the epigenetics of normal biology and cancer.
12099698 2002 Transforming growth factor-beta-induced transcription of the Alzheimer beta-amyloid precursor protein gene involves interaction between the CTCF-complex and Smads.
12075007 2002 An evolutionarily conserved putative insulator element near the 3' boundary of the imprinted Igf2/H19 domain.
12054881 2002 Immunoprecipitation techniques for the analysis of transcription factor complexes.
11997516 2002 Conserved CTCF insulator elements flank the mouse and human beta-globin loci.
11971967 2002 Multiple nucleosome positioning sites regulate the CTCF-mediated insulator function of the H19 imprinting control region.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11782357 2002 Tumor-associated zinc finger mutations in the CTCF transcription factor selectively alter tts DNA-binding specificity.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11743158 2002 CTCF, a candidate trans-acting factor for X-inactivation choice.
11525835 2001 CTCF is a uniquely versatile transcription regulator linked to epigenetics and disease.
10906122 2000 Physical and functional interaction between two pluripotent proteins, the Y-box DNA/RNA-binding factor, YB-1, and the multivalent zinc finger factor, CTCF.
10839547 2000 CTCF mediates methylation-sensitive enhancer-blocking activity at the H19/Igf2 locus.
10839546 2000 Methylation of a CTCF-dependent boundary controls imprinted expression of the Igf2 gene.
10734189 2000 Transcriptional repression by the insulator protein CTCF involves histone deacetylases.
10625678 2000 An element in the region responsible for premature termination of transcription mediates repression of c-myc gene expression by thyroid hormone in neuroblastoma cells.
10458613 1999 The protein CTCF is required for the enhancer blocking activity of vertebrate insulators.
9591631 1998 A widely expressed transcription factor with multiple DNA sequence specificity, CTCF, is localized at chromosome segment 16q22.1 within one of the smallest regions of overlap for common deletions in breast and prostate cancers.
9407128 1997 The zinc finger protein CTCF binds to the APBbeta domain of the amyloid beta-protein precursor promoter. Evidence for a role in transcriptional activation.
8649389 1996 An exceptionally conserved transcriptional repressor, CTCF, employs different combinations of zinc fingers to bind diverged promoter sequences of avian and mammalian c-myc oncogenes.