Property Summary

NCBI Gene PubMed Count 37
PubMed Score 13.95
PubTator Score 16.43

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (9)

PMID Text
25657029 These findings define an interaction between the common MIA2(I141M) variant and the ER stress/UPR system and specify a subgroup of PDAC patients who are more likely to benefit from adjuvant chemotherapy.
25202031 Sec12 recruitment to endoplasmic reticulum exit sites is organized by its direct interaction with cTAGE5, a previously characterized collagen cargo receptor component, which functions together with TANGO1 at endoplasmic reticulum exit sites.
23511560 Findings suggest that the roles of MIA2 might be based on the variety of the integrins and the subtypes of mitogen-activated protein kinase in oral carcinoma.
23054591 22 members of an Iranian family with basal ganglia calfication as well as 100 controls were genotyped for the C>G P521A variant of CTAGE5, but none were found.
22120627 HBx activates hepatoma cell growth and proliferation through repression of the potential tumor suppressor MIA2.
21525241 cTAGE5 forms a complex with TANGO1 (MIA3), a previously characterized cargo receptor for collagen VII
20838928 population and bioinformatic analysis of MGEA6 P521A variation as a risk factor for Fahr's disease; genetic screen data show this mutation is very rare; bioinformatics analysis provided conflicting findings
17881540 The novel gene MIA2 acts as a tumour suppressor in hepatocellular carcinoma.
12586826 Data indicate that MIA2 represents a potential novel acute phase protein and MIA2 expression responds to liver damage in chronic liver diseases.

AA Sequence

MEEPGVTPQPYLGLLLEELRRVVAALPEGMRPDSNLYGFPWELVICAAVVGFFAVLFFLWRSFRSVRSRL      1 - 70
YVGREKKLALMLSGLIEEKSKLLEKFSLVQKEYEGYEVESSLKDASFEKEATEAQSLEATCEKLNRSNSE     71 - 140
LEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKD    141 - 210
ALNENSQLQESQKQLLQEAEVWKEQVSELNKQKVTFEDSKVHAEQVLNDKESHIKTLTERLLKMKDWAAM    211 - 280
LGEDITDDDNLELEMNSESENGAYLDNPPKGALKKLIHAAKLNASLKTLEGERNQIYIQLSEVDKTKEEL    281 - 350
TEHIKNLQTEQASLQSENTHFENENQKLQQKLKVMTELYQENEMKLHRKLTVEENYRLEKEEKLSKVDEK    351 - 420
ISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTE    421 - 490
TELKFELLEKDPYALDVPNTAFGREHSPYGPSPLGWPSSETRAFLSPPTLLEGPLRLSPLLPGGGGRGSR    491 - 560
GPGNPLDHQITNERGESSCDRLTDPHRAPSDTGSLSPPWDQDRRMMFPPPGQSYPDSALPPQRQDRFCSN    561 - 630
SGRLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDDLGNLNVPDSSLPAENEATGPGFVPPPLAPIR    631 - 700
GPLFPVDARGPFLRRGPPFPPPPPGAMFGASRDYFPPGDFPGPPPAPFAMRNVYPPRGFPPYLPPRPGFF    701 - 770
PPPPHSEGRSEFPSGLIPPSNEPATEHPEPQQET                                        771 - 804
//

Text Mined References (37)

PMID Year Title
27170179 2016 Dual function of cTAGE5 in collagen export from the endoplasmic reticulum.
27138255 2016 TANGO1 and Mia2/cTAGE5 (TALI) cooperate to export bulky pre-chylomicrons/VLDLs from the endoplasmic reticulum.
25657029 2015 A common genetic variation of melanoma inhibitory activity-2 labels a subtype of pancreatic adenocarcinoma with high endoplasmic reticulum stress levels.
25416956 2014 A proteome-scale map of the human interactome network.
25202031 2014 Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23511560 2013 Protumoral roles of melanoma inhibitory activity 2 in oral squamous cell carcinoma.
23054591 2013 Analysis of the CTAGE5 P521A variation with the risk of familial idiopathic basal ganglia calcification in an Iranian population.
22120627 2011 The X protein of hepatitis B virus activates hepatoma cell proliferation through repressing melanoma inhibitory activity 2 gene.
21807889 2011 Reduced cholesterol and triglycerides in mice with a mutation in Mia2, a liver protein that localizes to ER exit sites.
21525241 2011 cTAGE5 mediates collagen secretion through interaction with TANGO1 at endoplasmic reticulum exit sites.
20838928 2011 Population and computational analysis of the MGEA6 P521A variation as a risk factor for familial idiopathic basal ganglia calcification (Fahr's disease).
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17881540 2008 The novel gene MIA2 acts as a tumour suppressor in hepatocellular carcinoma.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12839582 2003 cTAGE: a cutaneous T cell lymphoma associated antigen family with tumor-specific splicing.
12586826 2003 Specific expression and regulation of the new melanoma inhibitory activity-related gene MIA2 in hepatocytes.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11803467 2002 MGEA6 is tumor-specific overexpressed and frequently recognized by patient-serum antibodies.
11472066 2001 The MGEA6 multigene family has an active locus on 14q and at least nine pseudogenes on different chromosomes.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11181995 2001 The sequence of the human genome.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9356211 1997 cDNA cloning and chromosomal mapping of a predicted coiled-coil proline-rich protein immunogenic in meningioma patients.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.