Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCSAFLLLWQGEG      1 - 70
VNLR                                                                       71 - 74
//

Text Mined References (7)

PMID Year Title