Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.28
PubTator Score 161.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.448 1.7

Synonym

Accession O75638 O75637 Q0VIL6 Q14CD6 Q2Z1N4 Q9BU80 Q9UJ89 Q9Y479 CT2
Symbols CT2
ESO2
CAMEL
CT6.2
CT6.2a
CT6.2b
LAGE-1
LAGE2B

Gene

Gene RIF (15)

PMID Text
24885297 The tumor suppressor function of LSAMP is most likely exerted by reducing the proliferation rate of the tumor cells, possibly by indirectly upregulating one or more of the genes HES1, CTAG2 or KLF10.
22384167 NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine
21247062 LAGE-1a and NY-ESO-1 homology cannot be easily exploited in an anti-NY-ESO-1 vaccine given the low frequency of protein expression detected by IHC or serum analysis.
21131422 Spontaneous LAGE-1-specific CD4-positive T cells isolated from patients with advanced LAGE-1-positive/NY-ESO-1-positive melanoma are directed against three promiscuous and immunodominant epitopes.
19212631 We evaluated the correlations among the expression levels of NY-ESO-1, LAGE-1 and SSX-1 and clinical parameters in hepatocellular carcinoma patients
18237105 MAGEC1/CT7, MAGEA3/6 and LAGE-1 are good candidates for immunotherapy, since together they cover 85% of the multiple myeloma cases.
17899192 There is a high frequency of the LAGE-1 gene allele with SNPs in coding regions in cancer patients.
17899192 Observational study of gene-disease association. (HuGE Navigator)
16446548 LAGE-1 expression was detected in esophageal cancer by cDNA RDA. LAGE-1 might have the potential to be a target antigen for anti-tumoral immunotherapy in esophageal cancers because of its tumor-specific expression similar to that of MAGE-A1.
15540228 first peptide epitope recognized by sera from a wide spectrum of cancer patients but not healthy donors
15067093 Isolation of CD4+ T cell clones from T cell cultures of two healthy donors leads to identification of four naturally processed HLA-DR-binding CAMEL epitopes, interesting peptides to investigate for future cancer immunotherapy.
15061963 LAGE-1 expression was more frequently found in squamous cell carcinoma than in adenocarcinoma.
14559844 Data support the immunogenicity of NY-ESO-1/LAGE-1 ORF2 gene products and clearly demonstrate their capability to stimulate T-helper 1 type CD4+ T cells.
14522938 Data showed aberrant expression of NY-ESO-1 and LAGE-1 by IHC/RT-PCR in a significant proportion of epithelial ovarian cancer patients.
12538712 CD4+ T cell clones specific for alternatively translated tumor antigen CAMEL have been isolated from the peripheral blood of a melanoma patient; CAMEL(81-102) is described as a naturally processed epitope recognized and presented by HLA-DR11 and HLA-DR12.

AA Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAAS      1 - 70
AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQ     71 - 140
DREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI    141 - 210
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24885297 2014 Reexpression of LSAMP inhibits tumor growth in a preclinical osteosarcoma model.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
22384167 2012 NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine.
21247062 2011 Evaluation of LAGE-1 and NY-ESO-1 expression in multiple myeloma patients to explore possible benefits of their homology for immunotherapy.
21131422 2011 Epitope hierarchy of spontaneous CD4+ T cell responses to LAGE-1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19212631 2009 Comparisons for detecting NY-ESO-1 mRNA expression levels in hepatocellular carcinoma tissues.
18237105 2008 Prognostic impact of cancer/testis antigen expression in advanced stage multiple myeloma patients.
17899192 2008 Identification and expression analysis of novel LAGE-1 alleles with single nucleotide polymorphisms in cancer patients.
16446548 2006 A new specific gene expression in squamous cell carcinoma of the esophagus detected using representational difference analysis and cDNA microarray.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15540228 2005 Dominant B cell epitope from NY-ESO-1 recognized by sera from a wide spectrum of cancer patients: implications as a potential biomarker.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15067093 2004 Identification of multiple HLA-DR-restricted epitopes of the tumor-associated antigen CAMEL by CD4+ Th1/Th2 lymphocytes.
15061963 2004 [Expression of multiple cancer-testis antigen genes in non-small cell lung cancer treated by chemotherapy prior surgery].
14559844 2003 The alternative open reading frame of LAGE-1 gives rise to multiple promiscuous HLA-DR-restricted epitopes recognized by T-helper 1-type tumor-reactive CD4+ T cells.
14522938 2003 NY-ESO-1 and LAGE-1 cancer-testis antigens are potential targets for immunotherapy in epithelial ovarian cancer.
12538712 2003 CD4+ Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445278 2002 Cancer/testis antigens: an expanding family of targets for cancer immunotherapy.
11709543 2001 Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11120859 2000 Efficient simultaneous presentation of NY-ESO-1/LAGE-1 primary and nonprimary open reading frame-derived CTL epitopes in melanoma.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10399963 1999 Interleukin-2-induced, melanoma-specific T cells recognize CAMEL, an unexpected translation product of LAGE-1.
9626360 1998 LAGE-1, a new gene with tumor specificity.
9618514 1998 Identification of multiple cancer/testis antigens by allogeneic antibody screening of a melanoma cell line library.