Property Summary

NCBI Gene PubMed Count 46
PubMed Score 48.36
PubTator Score 42.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

 MGI Phenotype (1)

Gene RIF (13)

PMID Text
26496945 CstF-64 is dispensable for the expression/3'-end processing of Star-PAP target mRNAs.CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding poly A polymerase.
25409906 CstF64, an essential polyadenylation factor, is a master regulator of 3'-UTR shortening across multiple tumour types.
25266659 CstF64 is central to the function of a heat-labile factor, composed of cleavage/polyadenylation specificity factor, symplekin, and cleavage stimulation factor 64 and appears to be at least partly responsible for its cell cycle regulation.
24149845 CstF64 and CstF64tau modulate one another's expression and play overlapping as well as distinct roles in regulating global alternative polyadenylation profiles.
23112178 CstF64 binds to thousands of dormant intronic PASs that are suppressed, at least in part, by U1 small nuclear ribonucleoproteins
22174317 HIV-1 Rev interacting protein, cleavage stimulation factor, subunit 2 (CSTF2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSTF2 is increased by RRE
21813631 CSTF2 is likely to play an important role in lung carcinogenesis and be a prognostic biomarker in the clinic.
21119002 nuclear accumulation of CstF-64 depends on binding to CstF-77 not symplekin; interaction between CstF-64/CstF-64Tau and CstF-77 are important for maintenance of nuclear levels of CstF complex components and intracellular localization, stability, function
19887456 The Hinge domain is necessary for CstF-64 interaction with CstF-77 and consequent nuclear localization.
18272196 The inactivity of the RSV poly(A) site was at least in part due to poor CstF binding since tethering CstF to the RSV substrate activated polyadenylation.
16207706 CstF64 (cstf2) and not other CstF subunits induced by lipopolysaccharide (LPS) in murine macrophages and changes polyA site use
15769465 dynamics of the CstF-64 RNA-binding domain, both free and bound to two GU-rich RNA sequences that represent polyadenylation regulatory elements, by NMR Spectroscopy
9736695 Describes the induction of CSTF2 in the growth phase of cells.

AA Sequence

MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA      1 - 70
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM     71 - 140
FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG    141 - 210
AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA    211 - 280
QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP    281 - 350
HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM    351 - 420
EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM    421 - 490
GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR    491 - 560
QSILILKEQIQKSTGAP                                                         561 - 577
//

Text Mined References (56)

PMID Year Title
26496945 2016 CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding PAP?.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25409906 2014 Dynamic analyses of alternative polyadenylation from RNA-seq reveal a 3'-UTR landscape across seven tumour types.
25266659 2014 CstF64: cell cycle regulation and functional role in 3' end processing of replication-dependent histone mRNAs.
24149845 2013 Overlapping and distinct functions of CstF64 and CstF64? in mammalian mRNA 3' processing.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23112178 2012 Transcriptome-wide analyses of CstF64-RNA interactions in global regulation of mRNA alternative polyadenylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21813631 2011 Characterization of a cleavage stimulation factor, 3' pre-RNA, subunit 2, 64 kDa (CSTF2) as a therapeutic target for lung cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21119002 2011 Interactions of CstF-64, CstF-77, and symplekin: implications on localisation and function.
21102410 2010 The poly A polymerase Star-PAP controls 3'-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA.
20379136 2010 Nuclear deadenylation/polyadenylation factors regulate 3' processing in response to DNA damage.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19887456 2010 The hinge domain of the cleavage stimulation factor protein CstF-64 is essential for CstF-77 interaction, nuclear localization, and polyadenylation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19284619 2009 A family of splice variants of CstF-64 expressed in vertebrate nervous systems.
18688255 2008 Conserved motifs in both CPSF73 and CPSF100 are required to assemble the active endonuclease for histone mRNA 3'-end maturation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18305108 2008 CKIalpha is associated with and phosphorylates star-PAP and is also required for expression of select star-PAP target messenger RNAs.
18272196 2008 Characterization of Rous sarcoma virus polyadenylation site use in vitro.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17116658 2007 The C-terminal domains of vertebrate CstF-64 and its yeast orthologue Rna15 form a new structure critical for mRNA 3'-end processing.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16207706 2005 Elevated levels of the 64-kDa cleavage stimulatory factor (CstF-64) in lipopolysaccharide-stimulated macrophages influence gene expression and induce alternative poly(A) site selection.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15769465 2005 Protein and RNA dynamics play key roles in determining the specific recognition of GU-rich polyadenylation regulatory elements by human Cstf-64 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749727 2004 Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase.
14707147 2004 HSF1 modulation of Hsp70 mRNA polyadenylation via interaction with symplekin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773396 2003 Recognition of GU-rich polyadenylation regulatory elements by human CstF-64 protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11598190 2001 Association of human DEAD box protein DDX1 with a cleavage stimulation factor involved in 3'-end processing of pre-MRNA.
11389848 2001 Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination.
11113135 2001 The gene for a variant form of the polyadenylation protein CstF-64 is on chromosome 19 and is expressed in pachytene spermatocytes in mice.
10669729 2000 Complex protein interactions within the human polyadenylation machinery identify a novel component.
10477523 1999 Functional interaction of BRCA1-associated BARD1 with polyadenylation factor CstF-50.
9885564 1998 Levels of polyadenylation factor CstF-64 control IgM heavy chain mRNA accumulation and other events associated with B cell differentiation.
9736695 1998 Increase in the 64-kDa subunit of the polyadenylation/cleavage stimulatory factor during the G0 to S phase transition.
9199325 1997 RNA recognition by the human polyadenylation factor CstF.
8945520 1996 The polyadenylation factor CstF-64 regulates alternative processing of IgM heavy chain pre-mRNA during B cell differentiation.
8654386 1996 The RNA 3' cleavage factors CstF 64 kDa and CPSF 100 kDa are concentrated in nuclear domains closely associated with coiled bodies and newly synthesized RNA.
8626397 1996 Purification and characterization of human cleavage factor Im involved in the 3' end processing of messenger RNA precursors.
7984242 1994 A polyadenylation factor subunit is the human homologue of the Drosophila suppressor of forked protein.
7590244 1995 The 160-kD subunit of human cleavage-polyadenylation specificity factor coordinates pre-mRNA 3'-end formation.
1741396 1992 The human 64-kDa polyadenylylation factor contains a ribonucleoprotein-type RNA binding domain and unusual auxiliary motifs.
1358884 1992 A human polyadenylation factor is a G protein beta-subunit homologue.