Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.59
PubTator Score 7.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.8e-05
ovarian cancer 8491 6.4e-04
group 3 medulloblastoma 2254 3.0e-03
lung cancer 4473 9.9e-03
acute myeloid leukemia 785 1.4e-02

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.392 4.8e-05
lung cancer 1.300 9.9e-03
group 3 medulloblastoma 1.200 3.0e-03
acute myeloid leukemia -1.100 1.4e-02
ovarian cancer 1.200 6.4e-04

Gene RIF (8)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18842000 characterize the BARD1 structural biochemistry responsible for CstF-50 binding
18676680 Observational study of gene-disease association. (HuGE Navigator)
15878232 A deletion variant of BARD1, a BRCA1 partner, occurs in cells and interacts with and colocalizes with CstF-50.

AA Sequence

MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIG      1 - 70
RSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERM     71 - 140
LAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRA    141 - 210
FKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTG    211 - 280
SKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS    281 - 350
GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR    351 - 420
ARFWYRRSTTD                                                               421 - 431
//

Text Mined References (28)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18842000 2008 The BARD1 C-terminal domain structure and interactions with polyadenylation factor CstF-50.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
15878232 2006 A truncated splice variant of human BARD1 that lacks the RING finger and ankyrin repeats.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11459828 2001 Capping, splicing, and 3' processing are independently stimulated by RNA polymerase II: different functions for different segments of the CTD.
11257228 2001 The BARD1-CstF-50 interaction links mRNA 3' end formation to DNA damage and tumor suppression.
10669729 2000 Complex protein interactions within the human polyadenylation machinery identify a novel component.
10477523 1999 Functional interaction of BRCA1-associated BARD1 with polyadenylation factor CstF-50.
8626397 1996 Purification and characterization of human cleavage factor Im involved in the 3' end processing of messenger RNA precursors.
7984242 1994 A polyadenylation factor subunit is the human homologue of the Drosophila suppressor of forked protein.
7590244 1995 The 160-kD subunit of human cleavage-polyadenylation specificity factor coordinates pre-mRNA 3'-end formation.
1741396 1992 The human 64-kDa polyadenylylation factor contains a ribonucleoprotein-type RNA binding domain and unusual auxiliary motifs.
1358884 1992 A human polyadenylation factor is a G protein beta-subunit homologue.