Property Summary

NCBI Gene PubMed Count 26
PubMed Score 6.45
PubTator Score 7.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.8e-05
ovarian cancer 8520 6.4e-04
group 3 medulloblastoma 4104 3.0e-03
acute myeloid leukemia 783 1.4e-02
lung cancer 4740 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.100 1.4e-02
group 3 medulloblastoma 1.200 3.0e-03
lung cancer 1.100 3.5e-02
osteosarcoma -1.392 4.8e-05
ovarian cancer 1.200 6.4e-04

Synonym

Accession Q05048 Q5QPD8
Symbols CstF-50
CstFp50

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIG      1 - 70
RSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERM     71 - 140
LAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRA    141 - 210
FKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTG    211 - 280
SKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS    281 - 350
GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR    351 - 420
ARFWYRRSTTD                                                               421 - 431
//

Text Mined References (28)

PMID Year Title