Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.06
PubTator Score 4.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Borderline personality disorder 12 4.378 2.2

Gene RIF (3)

PMID Text
20565543 We show with phylogenetic relations that the CTES genes are clustered into three original groups, a testatin, a Cres, and a CstL1 group
18976975 Knockdown of cystatin 9-like (CST9L) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
11756564 Results describe the sequence, genomic structure, chromosomal location, and expression pattern of the human testatin gene.

AA Sequence

MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL      1 - 70
GHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTFTCFFTISTRPWMTQFSLLNK     71 - 140
TCLEGFH                                                                   141 - 147
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
17903292 2007 A genome-wide association for kidney function and endocrine-related traits in the NHLBI's Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12644294 2003 A new subgroup of the family 2 cystatins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11756564 2002 Isolation of the human testatin gene and analysis in patients with abnormal gonadal development.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.