Property Summary

NCBI Gene PubMed Count 41
PubMed Score 43.29
PubTator Score 53.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -3.500 1.5e-04
ductal carcinoma in situ 1.700 2.4e-02
esophageal adenocarcinoma -2.200 3.2e-02
invasive ductal carcinoma 1.400 2.3e-02
lung adenocarcinoma -1.100 3.3e-02
nasopharyngeal carcinoma -1.200 1.6e-06
non-small cell lung cancer -2.044 1.4e-11
ovarian cancer -2.400 5.3e-07
pancreatic cancer 1.300 1.6e-02
psoriasis -1.200 1.9e-03

Gene RIF (27)

AA Sequence

MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFR      1 - 70
DTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQ     71 - 140
LLKHNCVQM                                                                 141 - 149
//

Text Mined References (41)

PMID Year Title