Property Summary

NCBI Gene PubMed Count 24
PubMed Score 41.47
PubTator Score 19.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.600 1.1e-03

Gene RIF (6)

AA Sequence

MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQ      1 - 70
VMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCR     71 - 140
KV                                                                        141 - 142
//

Text Mined References (25)

PMID Year Title