Property Summary

NCBI Gene PubMed Count 33
PubMed Score 50.58
PubTator Score 39.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4473 8.9e-07
pancreatic cancer 2300 2.2e-02
primary pancreatic ductal adenocarcinoma 1271 2.2e-02
psoriasis 6685 2.4e-02
colon cancer 1475 2.6e-02
Disease Target Count Z-score Confidence
Kidney disease 397 0.0 2.0
Disease Target Count Z-score Confidence
Dental caries 67 3.479 1.7

Gene RIF (1)

PMID Text
24261636 Findings suggest the mechanism of inhibition of SAP-1 (an N-terminal truncated form of cystatin S) for different proteases.

AA Sequence

MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQV      1 - 70
LRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQE     71 - 140
A//

Text Mined References (36)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24952865 2014 Polymorphism of the cystatin C gene in patients with acute coronary syndromes: Results from the PLATelet inhibition and patient Outcomes study.
24261636 2015 Studies on the interactions of SAP-1 (an N-terminal truncated form of cystatin S) with its binding partners by CD-spectroscopic and molecular docking methods.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11879580 2002 Expression of type 2 cystatin genes CST1-CST5 in adult human tissues and the developing submandibular gland.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10483070 1999 Functional aspects of the human salivary cystatins in the oral environment.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8636877 1996 Protein composition of whole and parotid saliva in healthy and periodontitis subjects. Determination of cystatins, albumin, amylase and IgA.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
6501254 1984 Isolation and amino acid sequence of SAP-1, an acidic protein of human whole saliva, and sequence homology with human gamma-trace.
6394600 1984 Cystatin S: a cysteine proteinase inhibitor of human saliva.
3496880 1987 Identification of a long form of cystatin from human saliva by rapid microbore HPLC mapping.
3488317 1986 Isolation of six cysteine proteinase inhibitors from human urine. Their physicochemical and enzyme kinetic properties and concentrations in biological fluids.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.
1939105 1991 Structure and expression of the gene encoding cystatin D, a novel human cysteine proteinase inhibitor.
1898352 1991 Human salivary cystatin S. Cloning, sequence analysis, hybridization in situ and immunocytochemistry.
1898055 1991 Salivary cystatin SA-III, a potential precursor of the acquired enamel pellicle, is phosphorylated at both its amino- and carboxyl-terminal regions.
1801729 1991 The human cystatin gene family: cloning of three members and evolutionary relationship between cystatins and Bowman-Birk type proteinase inhibitors.
1778989 1991 Identification of full-sized forms of salivary (S-type) cystatins (cystatin SN, cystatin SA, cystatin S, and two phosphorylated forms of cystatin S) in human whole saliva and determination of phosphorylation sites of cystatin S.
1747107 1991 Large-scale purification and characterization of the major phosphoproteins and mucins of human submandibular-sublingual saliva.
1741693 1991 The effects of human salivary cystatins and statherin on hydroxyapatite crystallization.
1471486 1992 Immunofluorescence localization of cystatins in human lacrimal gland and in the exorbital lacrimal gland of the rat.
1334620 1992 Characterization of two members (CST4 and CST5) of the cystatin gene family and molecular evolution of cystatin genes.