Property Summary

NCBI Gene PubMed Count 37
PubMed Score 20.62
PubTator Score 43.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
rhinitis with controlled asthma 1.900 7.2e-03
uncontrolled asthma 2.500 4.5e-05
primary pancreatic ductal adenocarcinoma 1.523 1.6e-03
lung cancer 2.300 4.2e-05
non-inflammatory breast cancer 1.200 1.7e-02
lung carcinoma 1.100 1.8e-11
ductal carcinoma in situ 1.200 4.4e-02
pancreatic cancer 1.700 9.8e-03

Gene RIF (7)

PMID Text
23122533 This data suggests an autoimmune mechanism behind chronic mucocutaneous candidiasis in autoimmune polyendocrine syndrome type I and provides rationale for evaluating cystatin SA1 in antifungal therapy.
21846728 Identification of cystatin SA as a novel inhibitor of acid ceramidase.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
15829315 Murine monoclonal antibodies were made which can distinguish between CST1 and CST2.
12413693 cystatins SA1 and SA2 adhere to human fibroblasts and that the event results in tyrosine phosphorylation and upregulation of the release of IL-6 mediated enhancement of NF-kappa B activity.
12013824 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV      1 - 70
LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE     71 - 140
A//

Text Mined References (39)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25416956 2014 A proteome-scale map of the human interactome network.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23122533 2013 Autoimmunity and cystatin SA1 deficiency behind chronic mucocutaneous candidiasis in autoimmune polyendocrine syndrome type 1.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21846728 2011 Identification of cystatin SA as a novel inhibitor of acid ceramidase.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15829315 2005 Murine monoclonal antibody which can distinguish cystatins SA1 and SA2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15274116 2004 Cystatin C as a potential cerebrospinal fluid marker for the diagnosis of Creutzfeldt-Jakob disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413693 2002 Salivary cystatins induce interleukin-6 expression via cell surface molecules in human gingival fibroblasts.
12013824 2002 Sac I Restriction Fragment Length Polymorphism (RFLP) related to the human CST2 gene.
11879580 2002 Expression of type 2 cystatin genes CST1-CST5 in adult human tissues and the developing submandibular gland.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11276250 2001 Human cystatin C, an amyloidogenic protein, dimerizes through three-dimensional domain swapping.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
6662498 1983 Protein inhibitors of cysteine proteinases. III. Amino-acid sequence of cystatin from chicken egg white.
6365094 1984 Human cystatin, a new protein inhibitor of cysteine proteinases.
6283552 1982 Human gamma-trace, a basic microprotein: amino acid sequence and presence in the adenohypophysis.
3495457 1987 Molecular cloning and sequence analysis of cDNA coding for the precursor of the human cysteine proteinase inhibitor cystatin C.
3446578 1987 Human cysteine-proteinase inhibitors: nucleotide sequence analysis of three members of the cystatin gene family.
3436950 1987 Characterization and amino acid sequence of a new acidic cysteine proteinase inhibitor (cystatin SA) structurally closely related to cystatin S, from human whole saliva.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.
2764935 1989 The human cystatin C gene (CST3) is a member of the cystatin gene family which is localized on chromosome 20.
2541223 1989 Stroke in Icelandic patients with hereditary amyloid angiopathy is related to a mutation in the cystatin C gene, an inhibitor of cysteine proteases.
2363674 1990 Structure and expression of the human cystatin C gene.
1898352 1991 Human salivary cystatin S. Cloning, sequence analysis, hybridization in situ and immunocytochemistry.
1778989 1991 Identification of full-sized forms of salivary (S-type) cystatins (cystatin SN, cystatin SA, cystatin S, and two phosphorylated forms of cystatin S) in human whole saliva and determination of phosphorylation sites of cystatin S.
1471486 1992 Immunofluorescence localization of cystatins in human lacrimal gland and in the exorbital lacrimal gland of the rat.
1352269 1992 Hereditary cystatin C amyloid angiopathy: identification of the disease-causing mutation and specific diagnosis by polymerase chain reaction based analysis.