Property Summary

NCBI Gene PubMed Count 31
PubMed Score 27.41
PubTator Score 40.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
rhinitis with controlled asthma 6.800 1.1e-05
uncontrolled asthma 7.900 1.3e-07
primary pancreatic ductal adenocarcinoma 3.091 1.1e-02
non-small cell lung carcinoma 2.400 4.9e-18
lung cancer 5.700 3.5e-07
pancreatic cancer 3.100 1.1e-02
diabetes mellitus 1.300 6.6e-03
lung adenocarcinoma 2.500 3.9e-09
invasive ductal carcinoma 1.475 2.3e-02
non-inflammatory breast cancer 1.500 6.7e-03
ductal carcinoma in situ 2.900 4.2e-02
psoriasis -1.100 2.2e-04

Gene RIF (9)

PMID Text
25648368 high expression of Cystatin SN is a significant prognostic indicator of a higher rate of recurrence, metastatic risk, and poor survival in patients with surgically resected NSCLCs.
25577248 In conclusion, our data suggest that CST1 might contribute to the proliferation of pancreatic cancer cells and could be a potential biomarker for the early detection of pancreatic cancer.
23950865 CST1 may contribute to inactivation of protease allergens and help re-establish homeostasis of the nasal membranes.
21636832 CST1 expression at both the messenger RNA and protein levels was barely detected in control cells, which included early passage proliferating, quiescent, or immortal human fibroblasts
19587831 Observational study of gene-disease association. (HuGE Navigator)
19513549 Identification of Cystatin SN as a novel tumor marker for colorectal cancer.
19463800 CST1 might be highly involved in gastric tumorigenesis and regulate the proteolytic activity of cysteine proteases.
19343046 Observational study of gene-disease association. (HuGE Navigator)
15829315 Murine monoclonal antibodies were made which can distinguish between CST1 and CST2.

AA Sequence

MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRV      1 - 70
LRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQE     71 - 140
S//

Text Mined References (33)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25648368 2015 Expression of Cystatin SN significantly correlates with recurrence, metastasis, and survival duration in surgically resected non-small cell lung cancer patients.
25577248 2015 Identification of cystatin SN as a novel biomarker for pancreatic cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23950865 2013 Cystatin SN upregulation in patients with seasonal allergic rhinitis.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21636832 2011 Novel expression of CST1 as candidate senescence marker.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
19587831 2009 A variation in the cerebroside sulfotransferase gene is linked to exercise-modified insulin resistance and to type 2 diabetes.
19513549 2009 Identification of Cystatin SN as a novel tumor marker for colorectal cancer.
19463800 2009 Upregulation of the cysteine protease inhibitor, cystatin SN, contributes to cell proliferation and cathepsin inhibition in gastric cancer.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
15829315 2005 Murine monoclonal antibody which can distinguish cystatins SA1 and SA2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11879580 2002 Expression of type 2 cystatin genes CST1-CST5 in adult human tissues and the developing submandibular gland.
11788998 2002 Newly identified proteins in human nasal lavage fluid from non-smokers and smokers using two-dimensional gel electrophoresis and peptide mass fingerprinting.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8708950 1996 Effect of periodontal treatment on the protein composition of whole and parotid saliva.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
3514272 1986 Characterization of a new cysteine proteinase inhibitor of human saliva, cystatin SN, which is immunologically related to cystatin S.
3446578 1987 Human cysteine-proteinase inhibitors: nucleotide sequence analysis of three members of the cystatin gene family.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.
2837486 1988 Purification, molecular cloning, and sequencing of salivary cystatin SA-1.
1898352 1991 Human salivary cystatin S. Cloning, sequence analysis, hybridization in situ and immunocytochemistry.
1778989 1991 Identification of full-sized forms of salivary (S-type) cystatins (cystatin SN, cystatin SA, cystatin S, and two phosphorylated forms of cystatin S) in human whole saliva and determination of phosphorylation sites of cystatin S.
1471486 1992 Immunofluorescence localization of cystatins in human lacrimal gland and in the exorbital lacrimal gland of the rat.