Property Summary

NCBI Gene PubMed Count 38
PubMed Score 93.76
PubTator Score 286.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
24934443 MLP contributes to the maintenance of cardiomyocyte cytoarchitecture by a mechanism involving its self-association and actin filament cross-linking.
24860983 study reports the discovery of an alternative splice variant of muscle lim protein encoded by the CSRP3 gene, designated as MLP-b, showing distinct expression in neuromuscular disease and direct roles in actin dynamics and muscle differentiation
22584587 KLF5 reverses hhLIM function from anti-proliferation to pro-proliferation through its interaction with hhLIM on the cyclin E promoter.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20474083 Observational study of genetic testing. (HuGE Navigator)
20201937 Observational study of gene-disease association. (HuGE Navigator)
20044516 The CSRP3-W4R mutation causes cardiomyopathy and heart failure in patients and engineered knock-in animals.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875404 Observational study of gene-disease association. (HuGE Navigator)
19752190 MLP binds directly to CFL2 in human cardiac and skeletal muscles.
19636821 Complete chemical shift assignment was achieved for the first LIM domain and for most of the second domain, the N-terminal and C-terminal linker and part of the intervening linker.
19412328 Observational study of gene-disease association. (HuGE Navigator)
19351738 CRP3/MLP is primarily expressed in arterial smooth muscle cells and that stretch is the main stimulus for CRP3/MLP induction in veins exposed to arterial haemodynamic conditions.
19293840 Observational study of gene-disease association. (HuGE Navigator)
19230835 The structure of both LIM domains of human MLP by nuclear magnetic resonance spectroscopy.
19035361 CSRP3 mutation was found involved in hypertrophic cardiomyopathy.
18513529 Observational study of gene-disease association. (HuGE Navigator)
18505755 Study used linkage analysis and identified a CSRP3 missense mutation in a large German family affected by hypertrophic cardiomyopathy.
18393774 These findings suggest that hhLIM is a typical LIM family member with powerful transcription activation.
18331358 A myocardial actin-binding protein that increases actin cytoskeleton stability by promoting bundling of actin filaments.
17519359 CSRP3, MUSTN1, SIX1, and FBXO32 expression changes in response to lengthening and shortening contractions in human muscle
12642359 Mutations in the CRP3/MLP gene can cause hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM).
12507422 CSRP3 is involved in cardiac mechanosensory processes, is localized to the sarcomeric Z-disc and human mutations cause cardiomyopathy(DCM)and heart failure.

AA Sequence

MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG      1 - 70
IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW     71 - 140
HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE                    141 - 194
//

Text Mined References (37)

PMID Year Title
27353086 2016 MLP and CARP are linked to chronic PKC? signalling in dilated cardiomyopathy.
24934443 2014 Human muscle LIM protein dimerizes along the actin cytoskeleton and cross-links actin filaments.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
22584587 2012 KLF5 and hhLIM cooperatively promote proliferation of vascular smooth muscle cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20201937 2010 Common susceptibility variants examined for association with dilated cardiomyopathy.
20044516 2010 A common MLP (muscle LIM protein) variant is associated with cardiomyopathy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875404 2009 The role of Lamin A/C mutations in Danish patients with idiopathic dilated cardiomyopathy.
19752190 2009 Muscle LIM protein interacts with cofilin 2 and regulates F-actin dynamics in cardiac and skeletal muscle.
19636821 2007 1H, 13C, and 15N assignment of the muscular LIM protein MLP/CRP3.
19412328 2008 Coding sequence mutations identified in MYH7, TNNT2, SCN5A, CSRP3, LBD3, and TCAP from 313 patients with familial or idiopathic dilated cardiomyopathy.
19351738 2009 Induction of CRP3/MLP expression during vein arterialization is dependent on stretch rather than shear stress.
19293840 2009 The role of sarcomere gene mutations in patients with idiopathic dilated cardiomyopathy.
19230835 2009 Structure and dynamics of the human muscle LIM protein.
19035361 2009 Diagnostic yield, interpretation, and clinical utility of mutation screening of sarcomere encoding genes in Danish hypertrophic cardiomyopathy patients and relatives.
18513529 2008 Relationship between sex, shape, and substrate in hypertrophic cardiomyopathy.
18505755 2008 Beyond the sarcomere: CSRP3 mutations cause hypertrophic cardiomyopathy.
18393774 2008 Human heart LIM protein has transcription activation ability related to LIM domain 1.
18331358 2008 hhLIM is a novel F-actin binding protein involved in actin cytoskeleton remodeling.
17519359 2007 Gene expression responses over 24 h to lengthening and shortening contractions in human muscle: major changes in CSRP3, MUSTN1, SIX1, and FBXO32.
15582318 2004 Tcap gene mutations in hypertrophic cardiomyopathy and dilated cardiomyopathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205937 2004 Decreased interactions of mutant muscle LIM protein (MLP) with N-RAP and alpha-actinin and their implication for hypertrophic cardiomyopathy.
12878195 2003 The LIM-only protein LMO4 modulates the transcriptional activity of HEN1.
12642359 2003 Mutations in the human muscle LIM protein gene in families with hypertrophic cardiomyopathy.
12507422 2002 The cardiac mechanical stretch sensor machinery involves a Z disc complex that is defective in a subset of human dilated cardiomyopathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127981 2002 Identification of putative mammalian D-lactate dehydrogenase enzymes.
11113014 2000 Downregulation and nuclear relocation of MLP during the progression of right ventricular hypertrophy induced by chronic pressure overload.
10751147 2000 The muscle regulatory and structural protein MLP is a cytoskeletal binding partner of betaI-spectrin.
9234731 1997 Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD.
8782062 1996 Characterization of a human cardiac gene which encodes for a LIM domain protein and is developmentally expressed in myocardial development.
7954791 1994 Muscle LIM protein, a novel essential regulator of myogenesis, promotes myogenic differentiation.
7499425 1995 The cysteine-rich protein family of highly related LIM domain proteins.
7490106 1995 Mapping of a human LIM protein (CLP) to human chromosome 11p15.1 by fluorescence in situ hybridization.