Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.55
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 3.7e-08
tuberculosis 2010 1.1e-06
osteosarcoma 7950 4.2e-06
Pick disease 1894 1.2e-04
invasive ductal carcinoma 2951 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 4.276 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.100 3.7e-08
invasive ductal carcinoma -1.152 1.1e-02
osteosarcoma 1.471 4.2e-06
Pick disease -1.400 1.2e-04
tuberculosis -1.400 1.1e-06

Synonym

Accession Q9H175 CSRNP-2
Symbols C12orf2
PPP1R72
TAIP-12
C12orf22
FAM130A1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MDAFTGSGLKRKFDDVDVGSSVSNSDDEISSSDSADSCDSLNPPTTASFTPTSILKRQKQLRRKNVRFDQ      1 - 70
VTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTK     71 - 140
NGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSR    141 - 210
EECGCDCRLYCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELES    211 - 280
KRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSASLD    281 - 350
SSIESLGVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYY    351 - 420
QVEQRPVLGVKGEPGTEEGSASFPKEKDLNVFSLPVTSLVACSSTDPAALCKSEVGKTPTLEALLPEDCN    421 - 490
PEEPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLAV                     491 - 543
//

Text Mined References (12)

PMID Year Title