Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.95
PubTator Score 4.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.300 2.1e-03
medulloblastoma, large-cell -1.200 1.9e-02
adrenocortical carcinoma -1.773 1.9e-06
primary pancreatic ductal adenocarcinoma 1.544 8.7e-03
non-small cell lung cancer -2.638 4.7e-24
Multiple Sclerosis 1.100 8.7e-03
lung adenocarcinoma -1.900 1.8e-12
sonic hedgehog group medulloblastoma -1.400 5.2e-04
psoriasis -1.300 6.1e-08
inflammatory breast cancer -2.200 3.1e-10
lung carcinoma -1.400 3.9e-07
spina bifida -1.374 3.6e-02
gastric carcinoma 1.100 4.4e-02
acute myeloid leukemia 1.300 2.7e-02
ulcerative colitis 1.200 8.5e-06
ovarian cancer 1.300 1.7e-02
pituitary cancer -1.700 1.1e-04
chronic rhinosinusitis -1.594 1.1e-02
pancreatic cancer 1.200 8.8e-03

Synonym

Accession Q96S65 Q69YY5 CSRNP-1
Symbols AXUD1
URAX1
TAIP-3
CSRNP-1
FAM130B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

PMID Text
23292452 Three candidate tumor-suppressor genes, SEMA3B, AXUD1 and GNAT1 may be involved in oral squamous cell carcinoma.

AA Sequence

MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGPWDQMPLPDRDFCGPRSFTPL      1 - 70
SILKRARRERPGRVAFDGITVFYFPRCQGFTSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKL     71 - 140
RQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQPYPARRRRAL    141 - 210
LRASGVRRIDREEKRELQALRQSREDCGCHCDRICDPETCSCSLAGIKCQMDHTAFPCGCCREGCENPMG    211 - 280
RVEFNQARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSS    281 - 350
DMTDSSTASSSASGTSEAPDCPTHPGLPGPGFQPGVDDDSLARILSFSDSDFGGEEEEEEEGSVGNLDNL    351 - 420
SCFHPADIFGTSDPGGLASWTHSYSGCSFTSGVLDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAG    421 - 490
RSSSVDLSLSSCDSFELLQALPDYSLGPHYTSQKVSDSLDNIEAPHFPLPGLSPPGDASSCFLESLMGFS    491 - 560
EPAAEALDPFIDSQFEDTVPASLMEPVPV                                             561 - 589
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23292452 2013 Screening of candidate tumor-suppressor genes in 3p21.3 and investigation of the methylation of gene promoters in oral squamous cell carcinoma.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17726538 2007 Characterization of a family of novel cysteine- serine-rich nuclear proteins (CSRNP).
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11526492 2001 Identification of AXUD1, a novel human gene induced by AXIN1 and its reduced expression in human carcinomas of the lung, liver, colon and kidney.