Property Summary

NCBI Gene PubMed Count 176
PubMed Score 508.57
PubTator Score 343.99

Knowledge Summary

Patent (1,184)

Expression

Gene RIF (88)

PMID Text
26562283 Data suggest that cryptochromes mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). [SYNOPSIS]
26562092 Data suggest that cryptochromes (Cry1 and Cry2) mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha).
26108355 AMPKalpha signalling suppresses EMT and secretion of chemokines in renal tubular epithelia through interaction with CK2beta to attenuate renal injury.
25788269 CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and may have role in malignant B-cell growth.
25486430 we propose that Foxc2 is functionally maintained in the cytoplasm of normal epithelial cells by CK2alpha/alpha'-mediated phosphorylation at serine 124, which is dependent on proper targeting of the holoenzyme via the CK2b regulatory subunit.
24216761 ARKL1 binds CK2beta through the KSSR motif and this involves a polyserine sequence resembling the CK2beta binding sequence in EBNA1.
24175891 Asymmetric alpha2beta2 tetramers of casein kinase 2 are organized in trimeric rings that correspond to inactive forms of the enzyme. The new crystal structures presented here reveal the symmetric architecture of the isolated active tetramers.
23816881 The study identifies casein kinase 2 as an NRF1-binding protein and finds that the knockdown of casein kinase 2 enhances the Nrf1-dependent expression of the proteasome subunit genes.
23599180 CK2alpha' exhibits a striking preference for caspase-3 phosphorylation in cells as compared to CK2alpha and that CK2beta exhibits the capacity to abolish caspase-3 phosphorylation
23580615 Data indicate that protein S phosphorylation by casein kinase 1 (CK1) and casein kinase 2 (CK2) increased activated proten C cofactor activity.
23076192 The high expression of protein kinase CK2beta is closely related to the carcinogenesis and malignancy of esophageal cancer.
22562247 Unbalanced expression of CK2 subunits may drive epithelial-to-mesenchymal transition, thereby contributing to tumour progression.
22174317 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
21944249 C-terminal domain of PLD2 can regulate CKII by accelerating CKIIbeta degradation in HCT116 cells
21755461 A dysregulation of CK2beta expression might contribute to epithelial-to-mesenchymal-transition induction during cancer progression.
21750988 An interaction of the adiponectin receptor 1 with the tetrameric complex and protein kinase CK2 as a key player in adiponectin signaling, is reported.
21730285 Results provide an important role of CK2 in regulating nuclear ERK activities.
21515457 The high expression of ck2beta in colorectal cancer is closely correlated to carcinogenesis and metastasis.
21514207 Our findings argue against the hypothesis that genetic variability in the G-Protein-Coupled Receptor Kinase 5 and Casein Kinase 2 genes modifies Parkinson disease susceptibility
21507959 CK2 enhances the protein level and activity of TTP via the modulation of the MKP-1-p38 MAPK signaling pathway; TGF-beta1 enhances the activity of CK2
21142136 Identification of key residues on CK2alpha and CK2beta that play a cooperative role in CK2alpha/CK2beta binding and thermodynamics is important to further understand how these subunits interact in order to form a tetramer.
21068236 Threonine at amino acid (aa) 770 and serine at aa 854 to 855 of RIG-I are phosphorylated by casein kinase II (CK2) in the resting state of the cell and dephosphorylated when cells are infected by RNA virus.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20576813 Freshly isolated peripheral blood mononuclear cells from patients with chronic lymphocytic leukemia (n = 44) showed significantly higher levels of phosphorylated Akt1,PTEN, and casein kinase 2 than healthy persons (n = 8).
20372791 analysis of interaction sites between Wee1 kinase and the regulatory beta-subunit of protein kinase CK2
20044958 The Casein Kinase 2 (CK2) was identified as a binding and regulatory partner for Mitogen- and stress-activated protein kinase(MSK1).
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851886 CK2 could phosphorylate TNFAIP1 in vitro and in vivo, which facilitated the distribution of TNFAIP1 in nucleus and enhanced its interaction with PCNA.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19808671 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
19759161 These experiments indicate that casein kinase II phosphorylation of varicella-zoster virus open reading frame 63 S186 occurs in the nucleus and possibly identify an initial molecular event operative in virus reactivation.
19592636 These studies support CK2beta as an important regulator of ALK-1 signaling and ALK-1-mediated functions in endothelial cells.
19542537 CK2-dependent phosphorylation controls the nuclear localization, aggregation and stability of ataxin-3.
19091862 Casein kinase 2 phosphorylates human cytomegalovirus pUL84, and this interaction is required for oriLyt-dependent DNA replication.
19056846 CK2beta is widely expressed in endometrial carcinoma , and suggest a role in cell proliferation and anchorage-independent cell growth
18835879 Observational study of gene-disease association. (HuGE Navigator)
18824508 presents unbound three-dimensional structure of a CK2beta construct that is fully capable of CK2alpha recruitment and quantify its affinity to CK2alpha thermodynamically
18587631 In epithelial cells, a fraction of CK2 is associated to the plasma membrane and that this localization is controlled by cell-matrix interactions.
18583988 Data show that these CK2-targeted motifs in MDC1 are required to mediate NBS1 association with chromatin-flanking sites of unrepaired DNA double-strand breaks.
18560763 These findings support the view that CK2beta regulates various intracellular processes by modulating the activity of protein kinases that are distinct from CK2.
18553059 Transcript amounts of the subunits CK2alpha and CK2beta and holoenzyme CK2 activity in 34 muscle biopsies of human patients with different muscle pathologies, were determined.
18469858 The regulatory beta-subunit of protein kinase CK2 regulates cell-cycle progression.
18451726 Further studies in transgenic mice and cultured cells suggest that cellular toxicity, including proteasomal dysfunction, increases casein kinase 2 activity, which results in elevated Ser129 alpha-syn phosphorylation.
18186541 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
18062282 There was a positive correlation between the expressions of CK2alpha and CK2beta in laryngeal squamous cell carcinoma.
17912454 protein kinase CK2 is involved in cell cycle regulation and indicate the mechanism by which CDC25A turnover might be regulated by Chk1 in the absence of DNA damage.
17681943 a stabilized form of CK2beta can be used to inhibit cell proliferation
17038328 hNopp140 serves as a negative regulator of CK2 and InsP(6) stimulates the activity of CK2 by blocking the interaction between hNopp140 and CK2
16895915 there is a functional link between S6K1 II and CK2 signaling, which involves the regulation of S6K1 II nuclear export by CK2-mediated phosphorylation of Ser-17
16806200 CK2 activity in Chinese Hamster Ovary (CHO) cells is entirely accounted for by the holoenzyme.
16225457 In vitro phosphorylation of eIF2beta also pointed to Ser2 as a preferred site for CK2 phosphorylation
15940255 These findings support the notion that CK2beta can act as a general modulator of remote docking sites in protein kinase--substrate interactions.
15485924 CK2 phosphorylation of La can affect production of the translational machinery
14645218 Casein kinase II (CKII) phosphorylates synphilin-1; beta subunit of this enzyme complex binds to synphilin-1. CKII-mediated phosphorylation of synphilin-1, rather than alpha-synuclein, modulates the aggregation into inclusion bodies.
14634006 microtubule-associated protein that confers microtubule stability in a phosphorylation-independent manner
12954211 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
12511551 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
12470599 results show that the Ring-H2 finger motif of CKBBP1 is necessary for efficient binding to CKIIbeta, as well as for optimal cell proliferation
12145206 FGF-1 binds to both the catalytic alpha-subunit & to the regulatory beta-subunit of CK2.The presence of FGF-1 or FGF-2 was found to enhance the autophosphorylation of CK2 beta.
12102635 sequencing of full-length DNA encoding subunits in platelets and megakaryocytic cells
12037680 Protein kinase CK2 dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TRCp and enhances beta-catenin degradation.
11972058 Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein
11827177 Localization of individual subunits of protein kinase CK2 to the endoplasmic reticulum and to the Golgi apparatus
11827176 Consequences of CK2 signaling to the nuclear matrix.
11827174 Transcriptional coordination of the genes encoding catalytic (CK2alpha) and regulatory (CK2beta) subunits of human protein kinase CK2.
11827171 Characterization of CK2 holoenzyme variants with regard to crystallization
11827168 Response of cancer cells to molecular interruption of the CK2 signal.
11827166 HIV-1 Rev transactivator: a beta-subunit directed substrate and effector of protein kinase CK2
11827166 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
11710515 Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins.
10984616 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
10964683 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
10944435 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
10641798 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
10549869 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
9881639 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
9654140 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
9185604 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
9151826 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
9092824 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
8806671 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
8659106 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
8548340 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
8139011 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
8107101 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
7794916 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
7491787 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE
1541298 HIV-1 Rev interacting protein, casein kinase 2 beta polypeptide (CSNK2B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSNK2B is decreased by RRE

AA Sequence

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD      1 - 70
LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC     71 - 140
MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP    141 - 210
VKTIR                                                                     211 - 215
//

Text Mined References (191)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26562283 2015 A New Role Discovered for a Well-Known Clock Protein.
26562092 2015 CRY Drives Cyclic CK2-Mediated BMAL1 Phosphorylation to Control the Mammalian Circadian Clock.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26108355 2015 AMPK?2 reduces renal epithelial transdifferentiation and inflammation after injury through interaction with CK2?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25788269 2015 Protein kinase CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and propels malignant B-cell growth.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25519132 2014 An AUTS2-Polycomb complex activates gene expression in the CNS.
25486430 2015 Casein kinase 2 prevents mesenchymal transformation by maintaining Foxc2 in the cytoplasm.
25344690 2014 Common variants associated with general and MMR vaccine-related febrile seizures.
24535599 2014 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24216761 2014 Identification of a novel protein interaction motif in the regulatory subunit of casein kinase 2.
24175891 2014 Active form of the protein kinase CK2 ?2?2 holoenzyme is a strong complex with symmetric architecture.
23816881 2013 The casein kinase 2-nrf1 axis controls the clearance of ubiquitinated proteins by regulating proteasome gene expression.
23599180 2013 Characterizing the convergence of protein kinase CK2 and caspase-3 reveals isoform-specific phosphorylation of caspase-3 by CK2?': implications for pathological roles of CK2 in promoting cancer cell survival.
23580615 2013 Phosphorylation of protein S by platelet kinases enhances its activated protein C cofactor activity.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23521802 2013 Intron retention and transcript chimerism conserved across mammals: Ly6g5b and Csnk2b-Ly6g5b as examples.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23076192 2012 [Effect of casein kinase 2? in esophageal carcinoma and its clinical significance].
22562247 2013 Unbalanced expression of CK2 kinase subunits is sufficient to drive epithelial-to-mesenchymal transition by Snail1 induction.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21968188 2011 p53 deacetylation by SIRT1 decreases during protein kinase CKII downregulation-mediated cellular senescence.
21944249 2011 The C-terminal domain of PLD2 participates in degradation of protein kinase CKII ? subunit in human colorectal carcinoma cells.
21755461 2011 Regulation of epithelial to mesenchymal transition: CK2? on stage.
21750988 2011 Adiponectin receptor 1 interacts with both subunits of protein kinase CK2.
21730285 2011 Nuclear extracellular signal-regulated kinase 1 and 2 translocation is mediated by casein kinase 2 and accelerated by autophosphorylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21515457 2011 [Correlation of casein kinase 2? overexpression to the metastatic ability of colorectal cancer cells in vitro].
21514207 2011 Genetic variation in ?-synuclein kinases (CK-2? and GRK-5) and risk of Parkinson's disease.
21507959 2011 Casein kinase 2 regulates the mRNA-destabilizing activity of tristetraprolin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
21142136 2011 Interaction between CK2? and CK2?, the subunits of protein kinase CK2: thermodynamic contributions of key residues on the CK2? surface.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
21068236 2011 Phosphorylation of RIG-I by casein kinase II inhibits its antiviral response.
20664522 2010 Phosphorylation of CLIP-170 by Plk1 and CK2 promotes timely formation of kinetochore-microtubule attachments.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20576813 2010 Reconstitution of PTEN activity by CK2 inhibitors and interference with the PI3-K/Akt cascade counteract the antiapoptotic effect of human stromal cells in chronic lymphocytic leukemia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20372791 2010 Mapping of the interaction sites between Wee1 kinase and the regulatory beta-subunit of protein kinase CK2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20044958 2009 Casein kinase 2 interacts with human mitogen- and stress-activated protein kinase MSK1 and phosphorylates it at multiple sites.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851886 2010 CK2 phosphorylates TNFAIP1 to affect its subcellular localization and interaction with PCNA.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19759161 2009 Phosphorylation of the nuclear form of varicella-zoster virus immediate-early protein 63 by casein kinase II at serine 186.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19592636 2009 Casein kinase 2beta as a novel enhancer of activin-like receptor-1 signaling.
19542537 2009 CK2-dependent phosphorylation determines cellular localization and stability of ataxin-3.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19324893 2009 CK2 phosphorylation of the PRH/Hex homeodomain functions as a reversible switch for DNA binding.
19233263 2009 Protein kinase CK2 interacts with adiponectin receptor 1 and participates in adiponectin signaling.
19091862 2009 Interaction of human cytomegalovirus pUL84 with casein kinase 2 is required for oriLyt-dependent DNA replication.
19056846 2009 CK2beta is expressed in endometrial carcinoma and has a role in apoptosis resistance and cell proliferation.
19011756 2009 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit.
18835879 2008 Fine mapping of the MHC Class III region demonstrates association of AIF1 and rheumatoid arthritis.
18824508 2008 The interaction of CK2alpha and CK2beta, the subunits of protein kinase CK2, requires CK2beta in a preformed conformation and is enthalpically driven.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18587631 2008 Protein kinase CK2 and cell polarity.
18583988 2008 Phospho-dependent interactions between NBS1 and MDC1 mediate chromatin retention of the MRN complex at sites of DNA damage.
18560763 2008 Ability of CK2beta to selectively regulate cellular protein kinases.
18553059 2008 Examination of transcript amounts and activity of protein kinase CK2 in muscle lysates of different types of human muscle pathologies.
18469858 2008 The regulatory beta-subunit of protein kinase CK2 regulates cell-cycle progression at the onset of mitosis.
18451726 2008 Specificity and regulation of casein kinase-mediated phosphorylation of alpha-synuclein.
18062282 2007 [The expressions and significance of CK2 in normal laryngeal mucosa, laryngeal precancerosis and laryngeal squamous cell carcinoma].
17912454 2007 The regulatory beta-subunit of protein kinase CK2 accelerates the degradation of CDC25A phosphatase through the checkpoint kinase Chk1.
17681943 2007 Development of a stabilized form of the regulatory CK2beta subunit that inhibits cell proliferation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17092945 2006 A genome scale location analysis of human Staf/ZNF143-binding sites suggests a widespread role for human Staf/ZNF143 in mammalian promoters.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17038328 2006 Protein kinase CK2 is inhibited by human nucleolar phosphoprotein p140 in an inositol hexakisphosphate-dependent manner.
16977309 2006 A PACS-1, GGA3 and CK2 complex regulates CI-MPR trafficking.
16895915 2006 Nuclear export of S6K1 II is regulated by protein kinase CK2 phosphorylation at Ser-17.
16818610 2006 Casein kinase 2-dependent serine phosphorylation of MuSK regulates acetylcholine receptor aggregation at the neuromuscular junction.
16806200 2006 Discrimination between the activity of protein kinase CK2 holoenzyme and its catalytic subunits.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16225457 2006 The N-terminal domain of the human eIF2beta subunit and the CK2 phosphorylation sites are required for its function.
15940255 2005 The 'regulatory' beta-subunit of protein kinase CK2 negatively influences p53-mediated allosteric effects on Chk2 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485924 2004 CK2 is responsible for phosphorylation of human La protein serine-366 and can modulate rpL37 5'-terminal oligopyrimidine mRNA metabolism.
15225637 2004 Phosphorylation of the regulatory beta-subunit of protein kinase CK2 by checkpoint kinase Chk1: identification of the in vitro CK2beta phosphorylation site.
15218032 2004 Phosphorylation by protein kinase CK2 modulates the activity of the ATP binding cassette A1 transporter.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14645218 2004 Casein kinase II-mediated phosphorylation regulates alpha-synuclein/synphilin-1 interaction and inclusion body formation.
14634006 2004 Direct regulation of microtubule dynamics by protein kinase CK2.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12954211 2003 The presence of the casein kinase II phosphorylation sites of Vpu enhances the CD4(+) T cell loss caused by the simian-human immunodeficiency virus SHIV(KU-lbMC33) in pig-tailed macaques.
12902976 2003 Modulation of human checkpoint kinase Chk1 by the regulatory beta-subunit of protein kinase CK2.
12901717 2003 Eukaryotic translation-initiation factor eIF2beta binds to protein kinase CK2: effects on CK2alpha activity.
12804768 2003 Occludin phosphorylation: identification of an occludin kinase in brain and cell extracts as CK2.
12769847 2003 Phosphorylation of the WASP-VCA domain increases its affinity for the Arp2/3 complex and enhances actin polymerization by WASP.
12748192 2003 Phosphorylation of threonine 10 on CKBBP1/SAG/ROC2/Rbx2 by protein kinase CKII promotes the degradation of IkappaBalpha and p27Kip1.
12591939 2003 The C-terminal domain phosphatase and transcription elongation activities of FCP1 are regulated by phosphorylation.
12527891 2003 Protein kinase CK2 regulates CDC25B phosphatase activity.
12511551 2003 Role of protein kinase CK2 phosphorylation in the molecular chaperone activity of nucleolar protein b23.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470599 2002 The Ring-H2 finger motif of CKBBP1/SAG is necessary for interaction with protein kinase CKII and optimal cell proliferation.
12432063 2002 Protein kinase CKII regulates the interaction of beta-catenin with alpha-catenin and its protein stability.
12393879 2002 p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex.
12220519 2002 Heat-shock protein 90 complexes in resting and thrombin-activated platelets.
12145206 2002 Binding of FGF-1 variants to protein kinase CK2 correlates with mitogenicity.
12102635 2002 Sequencing of full-length cDNA encoding the alpha and beta subunits of human casein kinase II from human platelets and megakaryocytic cells. Expression of the casein kinase IIalpha intronless gene in a megakaryocytic cell line.
12037680 2002 CK2-dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TrCP and enhances beta-catenin degradation.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11972058 2002 Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein.
11964394 2002 Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor.
11940573 2002 Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions.
11883897 2002 Kinetic properties of p53 phosphorylation by the human vaccinia-related kinase 1.
11861906 2002 Phosphorylation of mammalian translation initiation factor 5 (eIF5) in vitro and in vivo.
11827178 2001 Visualization and molecular analysis of nuclear import of protein kinase CK2 subunits in living cells.
11827177 2001 Localization of individual subunits of protein kinase CK2 to the endoplasmic reticulum and to the Golgi apparatus.
11827176 2001 Consequences of CK2 signaling to the nuclear matrix.
11827174 2001 Transcriptional coordination of the genes encoding catalytic (CK2alpha) and regulatory (CK2beta) subunits of human protein kinase CK2.
11827171 2001 Characterization of CK2 holoenzyme variants with regard to crystallization.
11827168 2001 Response of cancer cells to molecular interruption of the CK2 signal.
11827167 2001 Protein kinase CK2: signaling and tumorigenesis in the mammary gland.
11827166 2001 HIV-1 Rev transactivator: a beta-subunit directed substrate and effector of protein kinase CK2.
11713579 2001 FAS-associated factor 1 interacts with protein kinase CK2 in vivo upon apoptosis induction.
11710515 2001 Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins.
11709713 2001 UV-radiation induces dose-dependent regulation of p53 response and modulates p53-HDM2 interaction in human fibroblasts.
11583622 2001 Phosphorylation of bid by casein kinases I and II regulates its cleavage by caspase 8.
11574463 2001 Crystal structure of human protein kinase CK2: insights into basic properties of the CK2 holoenzyme.
11546811 2001 Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2.
11535139 2001 Phosphorylation of the leucocyte NADPH oxidase subunit p47(phox) by casein kinase 2: conformation-dependent phosphorylation and modulation of oxidase activity.
11485312 2001 Regulation of protein kinase CKII by direct interaction with the C-terminal region of p47(phox).
11396975 2001 Possible implication of the Golgi apparatus casein kinase in the phosphorylation of vesicle docking protein p115 Ser-940: a study with peptide substrates.
11378439 2001 Phosphorylation of the Fas associated factor FAF1 by protein kinase CK2 and identification of serines 289 and 291 as the in vitro phosphorylation sites.
11298324 2001 Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C.
11239457 2001 A DNA damage-induced p53 serine 392 kinase complex contains CK2, hSpt16, and SSRP1.
11092945 2000 Crystallization and preliminary characterization of crystals of human protein kinase CK2.
11062072 2000 Bovine prion protein as a modulator of protein kinase CK2.
10984616 2000 Unique features of HIV-1 Rev protein phosphorylation by protein kinase CK2 ('casein kinase-2').
10951572 2000 The human vaccinia-related kinase 1 (VRK1) phosphorylates threonine-18 within the mdm-2 binding site of the p53 tumour suppressor protein.
10931861 2000 Phosphorylation of the vesicle-tethering protein p115 by a casein kinase II-like enzyme is required for Golgi reassembly from isolated mitotic fragments.
10764587 2000 PKC-zeta-associated CK2 participates in the turnover of free IkappaBalpha.
10747897 2000 Stress-induced activation of protein kinase CK2 by direct interaction with p38 mitogen-activated protein kinase.
10679299 2000 Binding domain for p21(WAF1) on the polypeptide chain of the protein kinase CK2 beta-subunit.
10549165 1999 Affinity properties of phosvitin: interaction of phosvitin with serine hydroxymethyl transferase.
10491318 1999 Phosphorylation of ribosomal protein L5 by protein kinase CKII decreases its 5S rRNA binding activity.
10403822 1999 Casein kinase 2 binds to and phosphorylates BRCA1.
10357806 1999 Crystal structure of the human protein kinase CK2 regulatory subunit reveals its zinc finger-mediated dimerization.
10327653 1999 Phylogenetically conserved CK-II phosphorylation site of the murine homeodomain protein Hoxb-6.
10214938 1999 Regulation of p53 mediated transactivation by the beta-subunit of protein kinase CK2.
10094400 1999 BTF3 is a potential new substrate of protein kinase CK2.
10094392 1999 Interactions of protein kinase CK2beta subunit within the holoenzyme and with other proteins.
9738462 1998 p53 and the ribosomal protein L5 participate in high molecular mass complex formation with protein kinase CK2 in murine teratocarcinoma cell line F9 after serum stimulation and cisplatin treatment.
9654140 1998 Biochemical characterization of HIV-1 Rev as a potent activator of casein kinase II in vitro.
9571630 1998 Characterization of protein interaction among subunits of protein kinase CKII in vivo and in vitro.
9503014 1998 Fine mapping of the autosomal recessive polycystic kidney disease locus (PKHD1) and the genes MUT, RDS, CSNK2 beta, and GSTA1 at 6p21.1-p12.
9478999 1998 Phosphorylation of the vesicle docking protein p115 regulates its association with the Golgi membrane.
9299532 1997 The highly basic ribosomal protein L41 interacts with the beta subunit of protein kinase CKII and stimulates phosphorylation of DNA topoisomerase IIalpha by CKII.
9188720 1997 Physical dissection of the structural elements responsible for regulatory properties and intersubunit interactions of protein kinase CK2 beta-subunit.
9185604 1997 Phosphorylation of both phosphoacceptor sites in the HIV-1 Vpu cytoplasmic domain is essential for Vpu-mediated ER degradation of CD4.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
9092824 1997 Nucleolar protein B23 stimulates nuclear import of the HIV-1 Rev protein and NLS-conjugated albumin.
9042965 1997 A-Raf kinase is a new interacting partner of protein kinase CK2 beta subunit.
9013635 1997 Specific interaction between casein kinase 2 and the nucleolar protein Nopp140.
8943850 1996 CD10/neutral endopeptidase 24.11 is phosphorylated by casein kinase II and coassociates with other phosphoproteins including the lyn src-related kinase.
8812450 1996 Localization of eight additional genes in the human major histocompatibility complex, including the gene encoding the casein kinase II beta subunit (CSNK2B).
8806671 1996 Phosphorylation of HIV-1 Rev protein: implication of protein kinase CK2 and pro-directed kinases.
8806611 1996 Interaction of the beta subunit of casein kinase II with the ribosomal protein L5.
8659106 1996 The human immunodeficiency virus type 1 Vpu protein tethered to the CD4 extracellular domain is localized to the plasma membrane and is biologically active in the secretory pathway of mammalian cells: implications for the mechanisms of Vpu function.
8548340 1995 Functional analysis of the phosphorylation sites on the human immunodeficiency virus type 1 Vpu protein.
8349691 1993 Phosphorylation of the insulin receptor substrate IRS-1 by casein kinase II.
8139011 1994 Differential activities of the human immunodeficiency virus type 1-encoded Vpu protein are regulated by phosphorylation and occur in different cellular compartments.
8107101 1994 The human immunodeficiency virus type 1 encoded Vpu protein is phosphorylated by casein kinase-2 (CK-2) at positions Ser52 and Ser56 within a predicted alpha-helix-turn-alpha-helix-motif.
8089108 1994 The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases.
7942276 1994 Human casein kinase II: structures, genes, expression and requirement in cell growth stimulation.
7838153 1994 Serine 167 is the major estradiol-induced phosphorylation site on the human estrogen receptor.
7794916 1995 Interaction of nucleolar protein B23 with peptides related to nuclear localization signals.
7689229 1993 The 25-kDa FK506-binding protein is localized in the nucleus and associates with casein kinase II and nucleolin.
7578274 1995 The protein kinase from mitotic human cells that phosphorylates Ser-209 on the casein kinase II beta-subunit is p34cdc2.
7491787 1995 The human immunodeficiency virus type 1 Vpu protein: a potential regulator of proteolysis and protein transport in the mammalian secretory pathway.
2666134 1989 Human phosvitin/casein kinase type II. Molecular cloning and sequencing of full-length cDNA encoding subunit beta.
2513884 1989 Cloning and characterization of a cDNA encoding the beta subunit of human casein kinase II.
2300566 1990 Stimulation of casein kinase II by epidermal growth factor: relationship between the physiological activity of the kinase and the phosphorylation state of its beta subunit.
2276748 1990 Assignment of the human casein kinase II beta-subunit gene to 6p12----p21.
1939094 1991 Phosphorylation of the beta subunit of casein kinase II in human A431 cells. Identification of the autophosphorylation site and a site phosphorylated by p34cdc2.
1856204 1991 Structure of the gene encoding human casein kinase II subunit beta.
1694965 1990 Expression of the cDNA for the beta subunit of human casein kinase II confers partial UV resistance on xeroderma pigmentosum cells.
1541298 1992 Human-immunodeficiency-virus-type-1-encoded Vpu protein is phosphorylated by casein kinase II.