| Tchem | Casein kinase II subunit alpha' |
Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.
Comments
| Disease | Target Count |
|---|---|
| Skin Neoplasms | 49 |
| Squamous cell carcinoma | 96 |
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8491 | 9.6e-08 |
| diabetes mellitus | 1663 | 1.4e-03 |
| psoriasis | 6685 | 5.0e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 5.5e-03 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 1.3e-02 |
| Disease | log2 FC | p |
|---|---|---|
| psoriasis | 1.200 | 5.0e-03 |
| intraductal papillary-mucinous carcinoma... | -1.100 | 5.5e-03 |
| intraductal papillary-mucinous neoplasm ... | -1.100 | 1.3e-02 |
| diabetes mellitus | -1.100 | 1.4e-03 |
| ovarian cancer | -1.700 | 9.6e-08 |
CHEMBL3699249
pIC50 7.60
CHEMBL1928905
pKi 7.62
CHEMBL1233807
pKi 7.68
CHEMBL3699246
pIC50 7.68
CHEMBL595730
pKi 7.68
CHEMBL3699298
pIC50 7.71
CHEMBL3759193
pIC50 7.72
CHEMBL3699299
pIC50 7.80
CHEMBL3699243
pIC50 7.81
CHEMBL475251
pKd 7.85
CHEMBL3758777
pIC50 7.85
CHEMBL3758895
pIC50 7.89
CHEMBL3760064
pIC50 7.92
CHEMBL3758270
pIC50 7.92
CHEMBL2087023
pIC50 7.96
CHEMBL3760009
pIC50 7.96
CHEMBL3759349
pIC50 7.96
CHEMBL1230165
pIC50 7.96
CHEMBL3758519
pIC50 8.00
CHEMBL3759755
pIC50 8.00
| PMID | Text | |
|---|---|---|
| 26430962 | results suggest that CK2alpha might play an oncogenic role in hepatocellular carcinoma | |
| 25936516 | We conclude that this class of chimeric peptides, in addition to altering some properties of CK2 holoenzyme, affects several other cellular targets, causing profound perturbations of cell biology | |
| 25788269 | CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and may have role in malignant B-cell growth. | |
| 25486430 | we propose that Foxc2 is functionally maintained in the cytoplasm of normal epithelial cells by CK2alpha/alpha'-mediated phosphorylation at serine 124, which is dependent on proper targeting of the holoenzyme via the CK2b regulatory subunit. | |
| 25422081 | Over-expressed CK2alpha positively regulate Hh/Gli1 signaling in human mesothelioma. | |
| 25272055 | Data suggest casein kinase II (CK2) inhibitors indeno[1,2-b]indole-9,10-dione, which also inhibited the breast cancer resistance protein ABCG2, might be a good therapeutic strategy to improve anticancer drug efficiency. | |
| 24795349 | CSNK2A2 phosphorylates telomeric repeat binding factor 1 and plays an important role for regulation of telomere length. | |
| 23599180 | CK2alpha' exhibits a striking preference for caspase-3 phosphorylation in cells as compared to CK2alpha and that CK2beta exhibits the capacity to abolish caspase-3 phosphorylation | |
| 22174317 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 21750982 | Lack of DNA-PKcs is accompanied by an increase in the protein level of one of the catalytic isozymes of protein kinase CK2, i.e., CK2alpha' and a concomitant increase in CK2 activity. | |
| 21739153 | In hsCK2alpha' an open conformation of the interdomain hinge/helix alphaD region that is critical for ATP-binding is found corresponding to an incomplete catalytic spine. In contrast hsCK2alpha often adopts the canonical, PKA-like version of the catalytic spine. | |
| 21730285 | Results provide an important role of CK2 in regulating nuclear ERK activities. | |
| 21142136 | A thorough investigation of CK2alpha identifies key energetic hot spots on the surface of CK2alpha and their thermostability and catalytic activity in comparison to the wild type subunit. | |
| 21093442 | Data presented the crystal structures of CK2alpha in complex with CX-4945 and adenylyl phosphoramidate at 2.7 and 1.3 A, respectively. | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19130553 | The CK2 alpha' phosphorylates APRIL and therefore is responsible for the regulation of the nucleocytoplasmic translocation of CD83 mRNA. | |
| 19011756 | Results identified the motor neuron protein KIF5C as a new binding partner for the protein kinase CK2alpha'. | |
| 18186541 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 17903308 | Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) | |
| 16335532 | Ets motifs play, in cooperation with Sp motif clusters, a central role in regulating CK2alpha' gene transcription. | |
| 12568341 | Data point to a particular role of the catalytic alpha and alpha' subunits of protein kinase CK2, which may be different from their roles in the holoenzyme. | |
| 12511551 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 12466282 | physiological control of G-protein regulation by phosducin-like protein seems to involve phosphorylation by CK2 and alternative splicing of the regulator | |
| 12145206 | FGF-1 binds to both the catalytic alpha-subunit & to the regulatory beta-subunit of CK2. FGF-1 & CK2 alpha are shown to interact in vivo. A correlation between the mitogenic potential of FGF-1 mutants & their ability to bind to CK2 alpha was observed. | |
| 12037680 | Protein kinase CK2 dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TRCp and enhances beta-catenin degradation [UBC3B] | |
| 11972058 | Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein | |
| 11827177 | Localization of individual subunits of protein kinase CK2 to the endoplasmic reticulum and to the Golgi apparatus | |
| 11827170 | Functional specialization of CK2 isoforms and characterization of isoform-specific binding partners | |
| 11827166 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 10984616 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 10964683 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 10944435 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 10641798 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 10549869 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 9881639 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 9654140 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 9185604 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 9151826 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 9092824 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 8806671 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 8659106 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 8548340 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 8139011 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 8107101 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 7794916 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 7491787 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro | |
| 1541298 | CK2 has been shown to phosphorylate HIV-1 Matrix in vitro |
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKI 1 - 70 LKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYE 71 - 140 LLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMY 141 - 210 DYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRK 211 - 280 RWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR 281 - 350 //
| PMID | Year | Title | |
|---|---|---|---|
| 26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. | |
| 26430962 | 2015 | Protein kinase CK2? catalytic subunit is overexpressed and serves as an unfavorable prognostic marker in primary hepatocellular carcinoma. | |
| 25936516 | 2015 | Chimeric peptides as modulators of CK2-dependent signaling: Mechanism of action and off-target effects. | |
| 25852190 | 2015 | Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy. | |
| 25788269 | 2015 | Protein kinase CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and propels malignant B-cell growth. | |
| 25486430 | 2015 | Casein kinase 2 prevents mesenchymal transformation by maintaining Foxc2 in the cytoplasm. | |
| 25422081 | 2014 | CK2?, over-expressed in human malignant pleural mesothelioma, regulates the Hedgehog signaling pathway in mesothelioma cells. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 25272055 | 2015 | Converting potent indeno[1,2-b]indole inhibitors of protein kinase CK2 into selective inhibitors of the breast cancer resistance protein ABCG2. | |
| 24912190 | 2014 | Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy. | |
| 24795349 | 2014 | Genome-wide association study identifies variants in casein kinase II (CSNK2A2) to be associated with leukocyte telomere length in a Punjabi Sikh diabetic cohort. | |
| 23599180 | 2013 | Characterizing the convergence of protein kinase CK2 and caspase-3 reveals isoform-specific phosphorylation of caspase-3 by CK2?': implications for pathological roles of CK2 in promoting cancer cell survival. | |
| 23555304 | 2013 | Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions. | |
| 23455922 | 2013 | Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 21988832 | 2011 | Toward an understanding of the protein interaction network of the human liver. | |
| 21750982 | 2011 | Lack of the catalytic subunit of DNA-dependent protein kinase (DNA-PKcs) is accompanied by increased CK2?' levels. | |
| 21739153 | 2011 | Enzymatic activity with an incomplete catalytic spine: insights from a comparative structural analysis of human CK2? and its paralogous isoform CK2?'. | |
| 21730285 | 2011 | Nuclear extracellular signal-regulated kinase 1 and 2 translocation is mediated by casein kinase 2 and accelerated by autophosphorylation. | |
| 21630459 | 2011 | Proteomic characterization of the human sperm nucleus. | |
| 21282530 | 2011 | Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21241709 | 2011 | Structure of the human protein kinase CK2 catalytic subunit CK2?' and interaction thermodynamics with the regulatory subunit CK2?. | |
| 21142136 | 2011 | Interaction between CK2? and CK2?, the subunits of protein kinase CK2: thermodynamic contributions of key residues on the CK2? surface. | |
| 21093442 | 2011 | Structural basis of CX-4945 binding to human protein kinase CK2. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. | |
| 19387553 | 2009 | Protein kinase CK2 in health and disease: Protein kinase CK2: from structures to insights. | |
| 19387552 | 2009 | Protein kinase CK2 in health and disease: From birth to death: the role of protein kinase CK2 in the regulation of cell proliferation and survival. | |
| 19387551 | 2009 | Protein kinase CK2 in health and disease: Cellular functions of protein kinase CK2: a dynamic affair. | |
| 19387550 | 2009 | Protein kinase CK2 in health and disease: CK2: the kinase controlling the Hsp90 chaperone machinery. | |
| 19387549 | 2009 | Protein kinase CK2 in health and disease: CK2 and its role in Wnt and NF-kappaB signaling: linking development and cancer. | |
| 19369195 | 2009 | Large-scale proteomics analysis of the human kinome. | |
| 19193990 | 2009 | Structure of human protein kinase CK2 alpha 2 with a potent indazole-derivative inhibitor. | |
| 19130553 | 2009 | Phosphorylation of the HuR ligand APRIL by casein kinase 2 regulates CD83 expression. | |
| 19011756 | 2009 | KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. | |
| 18691976 | 2008 | Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. | |
| 17903308 | 2007 | Genome-wide association of sleep and circadian phenotypes. | |
| 17353931 | 2007 | Large-scale mapping of human protein-protein interactions by mass spectrometry. | |
| 17344846 | 2007 | Patterns of somatic mutation in human cancer genomes. | |
| 16335532 | 2005 | The catalytic subunit alpha' gene of human protein kinase CK2 (CSNK2A2): genomic organization, promoter identification and determination of Ets1 as a key regulator. | |
| 16193064 | 2005 | Caspase-2 primes cancer cells for TRAIL-mediated apoptosis by processing procaspase-8. | |
| 15761153 | 2005 | High-throughput mapping of a dynamic signaling network in mammalian cells. | |
| 15635413 | 2005 | Nucleolar proteome dynamics. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15345747 | 2004 | Phosphoproteomic analysis of the developing mouse brain. | |
| 15302935 | 2004 | Large-scale characterization of HeLa cell nuclear phosphoproteins. | |
| 15218032 | 2004 | Phosphorylation by protein kinase CK2 modulates the activity of the ATP binding cassette A1 transporter. | |
| 14729942 | 2004 | Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 14685260 | 2004 | Regulation of InsP3 receptor activity by neuronal Ca2+-binding proteins. | |
| 14667819 | 2004 | Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region. | |
| 12930845 | 2003 | Phosphorylation of serine 13 is required for the proper function of the Hsp90 co-chaperone, Cdc37. | |
| 12860119 | 2003 | Phosphorylation of the N-terminal domain regulates subcellular localization and DNA binding properties of the peptidyl-prolyl cis/trans isomerase hPar14. | |
| 12783858 | 2003 | Protein profiling with Epstein-Barr nuclear antigen-1 reveals an interaction with the herpesvirus-associated ubiquitin-specific protease HAUSP/USP7. | |
| 12769847 | 2003 | Phosphorylation of the WASP-VCA domain increases its affinity for the Arp2/3 complex and enhances actin polymerization by WASP. | |
| 12631575 | 2003 | One-thousand-and-one substrates of protein kinase CK2? | |
| 12591939 | 2003 | The C-terminal domain phosphatase and transcription elongation activities of FCP1 are regulated by phosphorylation. | |
| 12588975 | 2003 | The C terminus of initiation factor 4E-binding protein 1 contains multiple regulatory features that influence its function and phosphorylation. | |
| 12568341 | 2002 | Specific localization of the catalytic subunits of protein kinase CK2 at the centrosomes. | |
| 12564933 | 2003 | Basal and hydrogen peroxide stimulated sites of phosphorylation in heterogeneous nuclear ribonucleoprotein C1/C2. | |
| 12558502 | 2003 | Protein kinase CK2 phosphorylates Hsp105 alpha at Ser509 and modulates its function. | |
| 12511551 | 2003 | Role of protein kinase CK2 phosphorylation in the molecular chaperone activity of nucleolar protein b23. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12466282 | 2003 | Regulation of phosducin-like protein by casein kinase 2 and N-terminal splicing. | |
| 12450396 | 2002 | Prointerleukin-16 contains a functional CcN motif that regulates nuclear localization. | |
| 12432063 | 2002 | Protein kinase CKII regulates the interaction of beta-catenin with alpha-catenin and its protein stability. | |
| 12393879 | 2002 | p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex. | |
| 12297295 | 2002 | Direct identification of PTEN phosphorylation sites. | |
| 12145206 | 2002 | Binding of FGF-1 variants to protein kinase CK2 correlates with mitogenicity. | |
| 12107178 | 2002 | The germ cell-specific transcription factor ALF. Structural properties and stabilization of the TATA-binding protein (TBP)-DNA complex. | |
| 12082111 | 2002 | Regulation of histone deacetylase 2 by protein kinase CK2. | |
| 12037680 | 2002 | CK2-dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TrCP and enhances beta-catenin degradation. | |
| 11972058 | 2002 | Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein. | |
| 11940573 | 2002 | Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions. | |
| 11877451 | 2002 | Regulation of arrestin-3 phosphorylation by casein kinase II. | |
| 11827177 | 2001 | Localization of individual subunits of protein kinase CK2 to the endoplasmic reticulum and to the Golgi apparatus. | |
| 11827172 | 2001 | A surface plasmon resonance study of the interactions between the component subunits of protein kinase CK2 and two protein substrates, casein and calmodulin. | |
| 11827170 | 2001 | Functional specialization of CK2 isoforms and characterization of isoform-specific binding partners. | |
| 11827166 | 2001 | HIV-1 Rev transactivator: a beta-subunit directed substrate and effector of protein kinase CK2. | |
| 11742978 | 2001 | Polarized trafficking and surface expression of the AQP4 water channel are coordinated by serial and regulated interactions with different clathrin-adaptor complexes. | |
| 11713579 | 2001 | FAS-associated factor 1 interacts with protein kinase CK2 in vivo upon apoptosis induction. | |
| 11711551 | 2002 | The transcriptional factor Tcf-4 contains different binding sites for beta-catenin and plakoglobin. | |
| 11704824 | 2001 | Protein kinase CK2 is involved in G2 arrest and apoptosis following spindle damage in epithelial cells. | |
| 11602581 | 2001 | Histone deacetylase 1 phosphorylation promotes enzymatic activity and complex formation. | |
| 11583622 | 2001 | Phosphorylation of bid by casein kinases I and II regulates its cleavage by caspase 8. | |
| 11557039 | 2001 | The carboxy-terminal domain of Grp94 binds to protein kinase CK2 alpha but not to CK2 holoenzyme. | |
| 11535139 | 2001 | Phosphorylation of the leucocyte NADPH oxidase subunit p47(phox) by casein kinase 2: conformation-dependent phosphorylation and modulation of oxidase activity. | |
| 11500362 | 2001 | Eukaryotic initiation factor 2B: identification of multiple phosphorylation sites in the epsilon-subunit and their functions in vivo. | |
| 11378439 | 2001 | Phosphorylation of the Fas associated factor FAF1 by protein kinase CK2 and identification of serines 289 and 291 as the in vitro phosphorylation sites. | |
| 11278496 | 2001 | Taf(II) 250 phosphorylates human transcription factor IIA on serine residues important for TBP binding and transcription activity. | |
| 11239457 | 2001 | A DNA damage-induced p53 serine 392 kinase complex contains CK2, hSpt16, and SSRP1. | |
| 11146653 | 2000 | Participation of ATM in insulin signalling through phosphorylation of eIF-4E-binding protein 1. | |
| 11062072 | 2000 | Bovine prion protein as a modulator of protein kinase CK2. | |
| 11034995 | 2001 | Distinct organization of DNA complexes of various HMGI/Y family proteins and their modulation upon mitotic phosphorylation. | |
| 11004567 | 2000 | Phosphohexose isomerase/autocrine motility factor/neuroleukin/maturation factor is a multifunctional phosphoprotein. | |
| 10994779 | 2000 | Subcellular localization of protein kinase CK2. A key to its function? | |
| 10993892 | 2000 | Erk1/2-dependent phosphorylation of Galpha-interacting protein stimulates its GTPase accelerating activity and autophagy in human colon cancer cells. | |
| 10984616 | 2000 | Unique features of HIV-1 Rev protein phosphorylation by protein kinase CK2 ('casein kinase-2'). | |
| 10982400 | 2000 | Characterization of the nucleolar gene product, treacle, in Treacher Collins syndrome. | |
| 10970045 | 2000 | Identification of a phosphatase activity, toward the phosphopeptide pyroGlu-Asp-Asp-Ser(p)-Asp-Glu-Glu-Asn, in nuclear extract from HL-60 promyelocitic leukaemia cells. | |
| 10961987 | 2000 | Phosphorylation of the beta-galactoside-binding protein galectin-3 modulates binding to its ligands. | |
| 10938077 | 2000 | Tumor necrosis factor alpha-induced phosphorylation of RelA/p65 on Ser529 is controlled by casein kinase II. | |
| 10852916 | 2000 | Synucleins are a novel class of substrates for G protein-coupled receptor kinases. | |
| 10844023 | 2000 | Phosphorylated syntaxin 1 is localized to discrete domains along a subset of axons. | |
| 10806215 | 2000 | Endogenous protein kinase CK2 participates in Wnt signaling in mammary epithelial cells. | |
| 10772927 | 2000 | Phosphorylation of the 105-kDa heat shock proteins, HSP105alpha and HSP105beta, by casein kinase II. | |
| 10764593 | 2000 | NAP-2: histone chaperone function and phosphorylation state through the cell cycle. | |
| 10760275 | 2000 | Membrane-associated GAIP is a phosphoprotein and can be phosphorylated by clathrin-coated vesicles. | |
| 10747897 | 2000 | Stress-induced activation of protein kinase CK2 by direct interaction with p38 mitogen-activated protein kinase. | |
| 10671552 | 2000 | Casein kinase II phosphorylation of E-cadherin increases E-cadherin/beta-catenin interaction and strengthens cell-cell adhesion. | |
| 10618498 | 1999 | Phosphorylation of the Spi-B transcription factor reduces its intrinsic stability. | |
| 10617630 | 2000 | Constitutive phosphorylation of the Parkinson's disease associated alpha-synuclein. | |
| 10559254 | 1999 | The kinesin-like motor protein KIF1C occurs in intact cells as a dimer and associates with proteins of the 14-3-3 family. | |
| 10471512 | 1999 | Globozoospermia in mice lacking the casein kinase II alpha' catalytic subunit. | |
| 10094392 | 1999 | Interactions of protein kinase CK2beta subunit within the holoenzyme and with other proteins. | |
| 10066810 | 1999 | Phosphorylation of CD45 by casein kinase 2. Modulation of activity and mutational analysis. | |
| 9930733 | 1999 | Differential phosphorylation of syntaxin and synaptosome-associated protein of 25 kDa (SNAP-25) isoforms. | |
| 9858576 | 1999 | Identification of the in vivo casein kinase II phosphorylation site within the homeodomain of the cardiac tisue-specifying homeobox gene product Csx/Nkx2.5. | |
| 9806882 | 1998 | Insulin-stimulated kinase from rat fat cells that phosphorylates initiation factor 4E-binding protein 1 on the rapamycin-insensitive site (serine-111). | |
| 9722526 | 1998 | Regulation of erythroid Krüppel-like factor (EKLF) transcriptional activity by phosphorylation of a protein kinase casein kinase II site within its interaction domain. | |
| 9685505 | 1998 | Casein kinase II interacts with the bZIP domains of several transcription factors. | |
| 9654140 | 1998 | Biochemical characterization of HIV-1 Rev as a potent activator of casein kinase II in vitro. | |
| 9600099 | 1998 | Multiple phosphorylation of chicken protein tyrosine phosphatase 1 and human protein tyrosine phosphatase 1B by casein kinase II and p60c-src in vitro. | |
| 9571630 | 1998 | Characterization of protein interaction among subunits of protein kinase CKII in vivo and in vitro. | |
| 9525959 | 1998 | Identification and partial characterization of factor Va heavy chain kinase from human platelets. | |
| 9461343 | 1997 | Two putative protein kinase CK2 phosphorylation sites are important for Myf-5 activity. | |
| 9407077 | 1997 | Properties and phosphorylation sites of baculovirus-expressed nuclear inhibitor of protein phosphatase-1 (NIPP-1). | |
| 9185604 | 1997 | Phosphorylation of both phosphoacceptor sites in the HIV-1 Vpu cytoplasmic domain is essential for Vpu-mediated ER degradation of CD4. | |
| 9151826 | 1997 | The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix. | |
| 9092824 | 1997 | Nucleolar protein B23 stimulates nuclear import of the HIV-1 Rev protein and NLS-conjugated albumin. | |
| 9074495 | 1997 | The putative cell cycle gene, enhancer of rudimentary, encodes a highly conserved protein found in plants and animals. | |
| 9045708 | 1997 | Phosphorylation of a vesicular monoamine transporter by casein kinase II. | |
| 8954982 | 1996 | Casein kinase 2 phosphorylates recombinant human spermidine/spermine N1-acetyltransferase on both serine and threonine residues. | |
| 8806671 | 1996 | Phosphorylation of HIV-1 Rev protein: implication of protein kinase CK2 and pro-directed kinases. | |
| 8663403 | 1996 | Phosphorylation of the MADS-Box transcription factor MEF2C enhances its DNA binding activity. | |
| 8663267 | 1996 | Phosphorylation of purified bovine bone sialoprotein and osteopontin by protein kinases. | |
| 8663258 | 1996 | The physical association of casein kinase 2 with nucleolin. | |
| 8659106 | 1996 | The human immunodeficiency virus type 1 Vpu protein tethered to the CD4 extracellular domain is localized to the plasma membrane and is biologically active in the secretory pathway of mammalian cells: implications for the mechanisms of Vpu function. | |
| 8639568 | 1996 | Identification of insulin-stimulated phosphorylation sites on calmodulin. | |
| 8622969 | 1996 | Human vitamin D receptor phosphorylation by casein kinase II at Ser-208 potentiates transcriptional activation. | |
| 8592152 | 1996 | Casein kinase II phosphorylates the neural cell adhesion molecule L1. | |
| 8548340 | 1995 | Functional analysis of the phosphorylation sites on the human immunodeficiency virus type 1 Vpu protein. | |
| 8547318 | 1995 | Expression of recombinant elongation factor 1 beta from rabbit in Escherichia coli. Phosphorylation by casein kinase II. | |
| 8491187 | 1993 | Multi-site phosphorylation of the protein tyrosine phosphatase, PTP1B: identification of cell cycle regulated and phorbol ester stimulated sites of phosphorylation. | |
| 8404858 | 1993 | Multiple and cooperative phosphorylation events regulate the CREM activator function. | |
| 8288648 | 1994 | Molecular mechanism of the synergistic phosphorylation of phosphatase inhibitor-2. Cloning, expression, and site-directed mutagenesis of inhibitor-2. | |
| 8253806 | 1993 | L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6 and serine 12 in vivo and by casein kinase I. | |
| 8206911 | 1994 | Isolation of phosphorylated calmodulin from rat liver and identification of the in vivo phosphorylation sites. | |
| 8188223 | 1994 | Assignment of the human casein kinase II alpha' subunit gene (CSNK2A1) to chromosome 16p13.2-p13.3. | |
| 8139011 | 1994 | Differential activities of the human immunodeficiency virus type 1-encoded Vpu protein are regulated by phosphorylation and occur in different cellular compartments. | |
| 8107101 | 1994 | The human immunodeficiency virus type 1 encoded Vpu protein is phosphorylated by casein kinase-2 (CK-2) at positions Ser52 and Ser56 within a predicted alpha-helix-turn-alpha-helix-motif. | |
| 8089108 | 1994 | The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases. | |
| 8058322 | 1994 | In vitro phosphorylation of caveolin-rich membrane domains: identification of an associated serine kinase activity as a casein kinase II-like enzyme. | |
| 7983041 | 1994 | Identification of phosphorylation sites unique to the B form of human progesterone receptor. In vitro phosphorylation by casein kinase II. | |
| 7896000 | 1995 | Protein kinases. 4. Protein kinase CK2: an enzyme with multiple substrates and a puzzling regulation. | |
| 7794926 | 1995 | Interaction between casein kinase II and the 90-kDa stress protein, HSP90. | |
| 7794916 | 1995 | Interaction of nucleolar protein B23 with peptides related to nuclear localization signals. | |
| 7735329 | 1994 | Activation of rDNA transcription by FGF-2: key role of protein kinase CKII. | |
| 7689229 | 1993 | The 25-kDa FK506-binding protein is localized in the nucleus and associates with casein kinase II and nucleolin. | |
| 7678037 | 1993 | Insulin regulates serine/threonine phosphorylation in activated human B lymphocytes. | |
| 7651819 | 1995 | Activation of mammalian ribosomal gene transcription requires phosphorylation of the nucleolar transcription factor UBF. | |
| 7491787 | 1995 | The human immunodeficiency virus type 1 Vpu protein: a potential regulator of proteolysis and protein transport in the mammalian secretory pathway. | |
| 3128543 | 1988 | Identification of the phosphorylation sites of clathrin light chain LCb. | |
| 2998765 | 1985 | Topoisomerase I phosphorylation in vitro and in rapidly growing Novikoff hepatoma cells. | |
| 2900140 | 1988 | Analysis of sites phosphorylated on acetyl-CoA carboxylase in response to insulin in isolated adipocytes. Comparison with sites phosphorylated by casein kinase-2 and the calmodulin-dependent multiprotein kinase. | |
| 2874131 | 1986 | Clathrin-coated vesicles contain two protein kinase activities. Phosphorylation of clathrin beta-light chain by casein kinase II. | |
| 2806554 | 1989 | Identification of sites on chromosomal protein HMG-I phosphorylated by casein kinase II. | |
| 2663470 | 1989 | Myc oncoproteins are phosphorylated by casein kinase II. | |
| 2557337 | 1989 | Phosphorylation of DARPP-32, a dopamine- and cAMP-regulated phosphoprotein, by casein kinase II. | |
| 2174700 | 1990 | Isolation and characterization of human cDNA clones encoding the alpha and the alpha' subunits of casein kinase II. | |
| 1985907 | 1991 | Phosphorylation of cardiac and skeletal muscle calsequestrin isoforms by casein kinase II. Demonstration of a cluster of unique rapidly phosphorylated sites in cardiac calsequestrin. | |
| 1766873 | 1991 | Mapping of the human casein kinase II catalytic subunit genes: two loci carrying the homologous sequences for the alpha subunit. | |
| 1740119 | 1992 | Casein kinase II phosphorylation increases the rate of serum response factor-binding site exchange. | |
| 1541298 | 1992 | Human-immunodeficiency-virus-type-1-encoded Vpu protein is phosphorylated by casein kinase II. | |
| 1520270 | 1992 | Insulin-stimulated phosphorylation of calmodulin. | |
| 1516134 | 1992 | Casein kinase II is a negative regulator of c-Jun DNA binding and AP-1 activity. | |
| 1425701 | 1992 | Specific phosphorylation of the acidic central region of the N-myc protein by casein kinase II. |
