Property Summary

NCBI Gene PubMed Count 165
PubMed Score 216.59
PubTator Score 26.07

Knowledge Summary

Patent (7,051)

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.200 5.0e-03
intraductal papillary-mucinous carcinoma... -1.100 5.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.3e-02
diabetes mellitus -1.100 1.4e-03
ovarian cancer -1.700 9.6e-08

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (49)

PMID Text
26430962 results suggest that CK2alpha might play an oncogenic role in hepatocellular carcinoma
25936516 We conclude that this class of chimeric peptides, in addition to altering some properties of CK2 holoenzyme, affects several other cellular targets, causing profound perturbations of cell biology
25788269 CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and may have role in malignant B-cell growth.
25486430 we propose that Foxc2 is functionally maintained in the cytoplasm of normal epithelial cells by CK2alpha/alpha'-mediated phosphorylation at serine 124, which is dependent on proper targeting of the holoenzyme via the CK2b regulatory subunit.
25422081 Over-expressed CK2alpha positively regulate Hh/Gli1 signaling in human mesothelioma.
25272055 Data suggest casein kinase II (CK2) inhibitors indeno[1,2-b]indole-9,10-dione, which also inhibited the breast cancer resistance protein ABCG2, might be a good therapeutic strategy to improve anticancer drug efficiency.
24795349 CSNK2A2 phosphorylates telomeric repeat binding factor 1 and plays an important role for regulation of telomere length.
23599180 CK2alpha' exhibits a striking preference for caspase-3 phosphorylation in cells as compared to CK2alpha and that CK2beta exhibits the capacity to abolish caspase-3 phosphorylation
22174317 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
21750982 Lack of DNA-PKcs is accompanied by an increase in the protein level of one of the catalytic isozymes of protein kinase CK2, i.e., CK2alpha' and a concomitant increase in CK2 activity.
21739153 In hsCK2alpha' an open conformation of the interdomain hinge/helix alphaD region that is critical for ATP-binding is found corresponding to an incomplete catalytic spine. In contrast hsCK2alpha often adopts the canonical, PKA-like version of the catalytic spine.
21730285 Results provide an important role of CK2 in regulating nuclear ERK activities.
21142136 A thorough investigation of CK2alpha identifies key energetic hot spots on the surface of CK2alpha and their thermostability and catalytic activity in comparison to the wild type subunit.
21093442 Data presented the crystal structures of CK2alpha in complex with CX-4945 and adenylyl phosphoramidate at 2.7 and 1.3 A, respectively.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19130553 The CK2 alpha' phosphorylates APRIL and therefore is responsible for the regulation of the nucleocytoplasmic translocation of CD83 mRNA.
19011756 Results identified the motor neuron protein KIF5C as a new binding partner for the protein kinase CK2alpha'.
18186541 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
17903308 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16335532 Ets motifs play, in cooperation with Sp motif clusters, a central role in regulating CK2alpha' gene transcription.
12568341 Data point to a particular role of the catalytic alpha and alpha' subunits of protein kinase CK2, which may be different from their roles in the holoenzyme.
12511551 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
12466282 physiological control of G-protein regulation by phosducin-like protein seems to involve phosphorylation by CK2 and alternative splicing of the regulator
12145206 FGF-1 binds to both the catalytic alpha-subunit & to the regulatory beta-subunit of CK2. FGF-1 & CK2 alpha are shown to interact in vivo. A correlation between the mitogenic potential of FGF-1 mutants & their ability to bind to CK2 alpha was observed.
12037680 Protein kinase CK2 dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TRCp and enhances beta-catenin degradation [UBC3B]
11972058 Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein
11827177 Localization of individual subunits of protein kinase CK2 to the endoplasmic reticulum and to the Golgi apparatus
11827170 Functional specialization of CK2 isoforms and characterization of isoform-specific binding partners
11827166 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
10984616 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
10964683 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
10944435 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
10641798 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
10549869 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
9881639 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
9654140 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
9185604 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
9151826 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
9092824 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
8806671 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
8659106 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
8548340 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
8139011 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
8107101 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
7794916 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
7491787 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
1541298 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro

AA Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKI      1 - 70
LKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYE     71 - 140
LLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMY    141 - 210
DYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRK    211 - 280
RWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR    281 - 350
//

Text Mined References (180)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26430962 2015 Protein kinase CK2? catalytic subunit is overexpressed and serves as an unfavorable prognostic marker in primary hepatocellular carcinoma.
25936516 2015 Chimeric peptides as modulators of CK2-dependent signaling: Mechanism of action and off-target effects.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25788269 2015 Protein kinase CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and propels malignant B-cell growth.
25486430 2015 Casein kinase 2 prevents mesenchymal transformation by maintaining Foxc2 in the cytoplasm.
25422081 2014 CK2?, over-expressed in human malignant pleural mesothelioma, regulates the Hedgehog signaling pathway in mesothelioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25272055 2015 Converting potent indeno[1,2-b]indole inhibitors of protein kinase CK2 into selective inhibitors of the breast cancer resistance protein ABCG2.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24795349 2014 Genome-wide association study identifies variants in casein kinase II (CSNK2A2) to be associated with leukocyte telomere length in a Punjabi Sikh diabetic cohort.
23599180 2013 Characterizing the convergence of protein kinase CK2 and caspase-3 reveals isoform-specific phosphorylation of caspase-3 by CK2?': implications for pathological roles of CK2 in promoting cancer cell survival.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21750982 2011 Lack of the catalytic subunit of DNA-dependent protein kinase (DNA-PKcs) is accompanied by increased CK2?' levels.
21739153 2011 Enzymatic activity with an incomplete catalytic spine: insights from a comparative structural analysis of human CK2? and its paralogous isoform CK2?'.
21730285 2011 Nuclear extracellular signal-regulated kinase 1 and 2 translocation is mediated by casein kinase 2 and accelerated by autophosphorylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
21241709 2011 Structure of the human protein kinase CK2 catalytic subunit CK2?' and interaction thermodynamics with the regulatory subunit CK2?.
21142136 2011 Interaction between CK2? and CK2?, the subunits of protein kinase CK2: thermodynamic contributions of key residues on the CK2? surface.
21093442 2011 Structural basis of CX-4945 binding to human protein kinase CK2.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19387553 2009 Protein kinase CK2 in health and disease: Protein kinase CK2: from structures to insights.
19387552 2009 Protein kinase CK2 in health and disease: From birth to death: the role of protein kinase CK2 in the regulation of cell proliferation and survival.
19387551 2009 Protein kinase CK2 in health and disease: Cellular functions of protein kinase CK2: a dynamic affair.
19387550 2009 Protein kinase CK2 in health and disease: CK2: the kinase controlling the Hsp90 chaperone machinery.
19387549 2009 Protein kinase CK2 in health and disease: CK2 and its role in Wnt and NF-kappaB signaling: linking development and cancer.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19193990 2009 Structure of human protein kinase CK2 alpha 2 with a potent indazole-derivative inhibitor.
19130553 2009 Phosphorylation of the HuR ligand APRIL by casein kinase 2 regulates CD83 expression.
19011756 2009 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17903308 2007 Genome-wide association of sleep and circadian phenotypes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16335532 2005 The catalytic subunit alpha' gene of human protein kinase CK2 (CSNK2A2): genomic organization, promoter identification and determination of Ets1 as a key regulator.
16193064 2005 Caspase-2 primes cancer cells for TRAIL-mediated apoptosis by processing procaspase-8.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15218032 2004 Phosphorylation by protein kinase CK2 modulates the activity of the ATP binding cassette A1 transporter.
14729942 2004 Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685260 2004 Regulation of InsP3 receptor activity by neuronal Ca2+-binding proteins.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12930845 2003 Phosphorylation of serine 13 is required for the proper function of the Hsp90 co-chaperone, Cdc37.
12860119 2003 Phosphorylation of the N-terminal domain regulates subcellular localization and DNA binding properties of the peptidyl-prolyl cis/trans isomerase hPar14.
12783858 2003 Protein profiling with Epstein-Barr nuclear antigen-1 reveals an interaction with the herpesvirus-associated ubiquitin-specific protease HAUSP/USP7.
12769847 2003 Phosphorylation of the WASP-VCA domain increases its affinity for the Arp2/3 complex and enhances actin polymerization by WASP.
12631575 2003 One-thousand-and-one substrates of protein kinase CK2?
12591939 2003 The C-terminal domain phosphatase and transcription elongation activities of FCP1 are regulated by phosphorylation.
12588975 2003 The C terminus of initiation factor 4E-binding protein 1 contains multiple regulatory features that influence its function and phosphorylation.
12568341 2002 Specific localization of the catalytic subunits of protein kinase CK2 at the centrosomes.
12564933 2003 Basal and hydrogen peroxide stimulated sites of phosphorylation in heterogeneous nuclear ribonucleoprotein C1/C2.
12558502 2003 Protein kinase CK2 phosphorylates Hsp105 alpha at Ser509 and modulates its function.
12511551 2003 Role of protein kinase CK2 phosphorylation in the molecular chaperone activity of nucleolar protein b23.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466282 2003 Regulation of phosducin-like protein by casein kinase 2 and N-terminal splicing.
12450396 2002 Prointerleukin-16 contains a functional CcN motif that regulates nuclear localization.
12432063 2002 Protein kinase CKII regulates the interaction of beta-catenin with alpha-catenin and its protein stability.
12393879 2002 p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex.
12297295 2002 Direct identification of PTEN phosphorylation sites.
12145206 2002 Binding of FGF-1 variants to protein kinase CK2 correlates with mitogenicity.
12107178 2002 The germ cell-specific transcription factor ALF. Structural properties and stabilization of the TATA-binding protein (TBP)-DNA complex.
12082111 2002 Regulation of histone deacetylase 2 by protein kinase CK2.
12037680 2002 CK2-dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TrCP and enhances beta-catenin degradation.
11972058 2002 Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein.
11940573 2002 Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions.
11877451 2002 Regulation of arrestin-3 phosphorylation by casein kinase II.
11827177 2001 Localization of individual subunits of protein kinase CK2 to the endoplasmic reticulum and to the Golgi apparatus.
11827172 2001 A surface plasmon resonance study of the interactions between the component subunits of protein kinase CK2 and two protein substrates, casein and calmodulin.
11827170 2001 Functional specialization of CK2 isoforms and characterization of isoform-specific binding partners.
11827166 2001 HIV-1 Rev transactivator: a beta-subunit directed substrate and effector of protein kinase CK2.
11742978 2001 Polarized trafficking and surface expression of the AQP4 water channel are coordinated by serial and regulated interactions with different clathrin-adaptor complexes.
11713579 2001 FAS-associated factor 1 interacts with protein kinase CK2 in vivo upon apoptosis induction.
11711551 2002 The transcriptional factor Tcf-4 contains different binding sites for beta-catenin and plakoglobin.
11704824 2001 Protein kinase CK2 is involved in G2 arrest and apoptosis following spindle damage in epithelial cells.
11602581 2001 Histone deacetylase 1 phosphorylation promotes enzymatic activity and complex formation.
11583622 2001 Phosphorylation of bid by casein kinases I and II regulates its cleavage by caspase 8.
11557039 2001 The carboxy-terminal domain of Grp94 binds to protein kinase CK2 alpha but not to CK2 holoenzyme.
11535139 2001 Phosphorylation of the leucocyte NADPH oxidase subunit p47(phox) by casein kinase 2: conformation-dependent phosphorylation and modulation of oxidase activity.
11500362 2001 Eukaryotic initiation factor 2B: identification of multiple phosphorylation sites in the epsilon-subunit and their functions in vivo.
11378439 2001 Phosphorylation of the Fas associated factor FAF1 by protein kinase CK2 and identification of serines 289 and 291 as the in vitro phosphorylation sites.
11278496 2001 Taf(II) 250 phosphorylates human transcription factor IIA on serine residues important for TBP binding and transcription activity.
11239457 2001 A DNA damage-induced p53 serine 392 kinase complex contains CK2, hSpt16, and SSRP1.
11146653 2000 Participation of ATM in insulin signalling through phosphorylation of eIF-4E-binding protein 1.
11062072 2000 Bovine prion protein as a modulator of protein kinase CK2.
11034995 2001 Distinct organization of DNA complexes of various HMGI/Y family proteins and their modulation upon mitotic phosphorylation.
11004567 2000 Phosphohexose isomerase/autocrine motility factor/neuroleukin/maturation factor is a multifunctional phosphoprotein.
10994779 2000 Subcellular localization of protein kinase CK2. A key to its function?
10993892 2000 Erk1/2-dependent phosphorylation of Galpha-interacting protein stimulates its GTPase accelerating activity and autophagy in human colon cancer cells.
10984616 2000 Unique features of HIV-1 Rev protein phosphorylation by protein kinase CK2 ('casein kinase-2').
10982400 2000 Characterization of the nucleolar gene product, treacle, in Treacher Collins syndrome.
10970045 2000 Identification of a phosphatase activity, toward the phosphopeptide pyroGlu-Asp-Asp-Ser(p)-Asp-Glu-Glu-Asn, in nuclear extract from HL-60 promyelocitic leukaemia cells.
10961987 2000 Phosphorylation of the beta-galactoside-binding protein galectin-3 modulates binding to its ligands.
10938077 2000 Tumor necrosis factor alpha-induced phosphorylation of RelA/p65 on Ser529 is controlled by casein kinase II.
10852916 2000 Synucleins are a novel class of substrates for G protein-coupled receptor kinases.
10844023 2000 Phosphorylated syntaxin 1 is localized to discrete domains along a subset of axons.
10806215 2000 Endogenous protein kinase CK2 participates in Wnt signaling in mammary epithelial cells.
10772927 2000 Phosphorylation of the 105-kDa heat shock proteins, HSP105alpha and HSP105beta, by casein kinase II.
10764593 2000 NAP-2: histone chaperone function and phosphorylation state through the cell cycle.
10760275 2000 Membrane-associated GAIP is a phosphoprotein and can be phosphorylated by clathrin-coated vesicles.
10747897 2000 Stress-induced activation of protein kinase CK2 by direct interaction with p38 mitogen-activated protein kinase.
10671552 2000 Casein kinase II phosphorylation of E-cadherin increases E-cadherin/beta-catenin interaction and strengthens cell-cell adhesion.
10618498 1999 Phosphorylation of the Spi-B transcription factor reduces its intrinsic stability.
10617630 2000 Constitutive phosphorylation of the Parkinson's disease associated alpha-synuclein.
10559254 1999 The kinesin-like motor protein KIF1C occurs in intact cells as a dimer and associates with proteins of the 14-3-3 family.
10471512 1999 Globozoospermia in mice lacking the casein kinase II alpha' catalytic subunit.
10094392 1999 Interactions of protein kinase CK2beta subunit within the holoenzyme and with other proteins.
10066810 1999 Phosphorylation of CD45 by casein kinase 2. Modulation of activity and mutational analysis.
9930733 1999 Differential phosphorylation of syntaxin and synaptosome-associated protein of 25 kDa (SNAP-25) isoforms.
9858576 1999 Identification of the in vivo casein kinase II phosphorylation site within the homeodomain of the cardiac tisue-specifying homeobox gene product Csx/Nkx2.5.
9806882 1998 Insulin-stimulated kinase from rat fat cells that phosphorylates initiation factor 4E-binding protein 1 on the rapamycin-insensitive site (serine-111).
9722526 1998 Regulation of erythroid Krüppel-like factor (EKLF) transcriptional activity by phosphorylation of a protein kinase casein kinase II site within its interaction domain.
9685505 1998 Casein kinase II interacts with the bZIP domains of several transcription factors.
9654140 1998 Biochemical characterization of HIV-1 Rev as a potent activator of casein kinase II in vitro.
9600099 1998 Multiple phosphorylation of chicken protein tyrosine phosphatase 1 and human protein tyrosine phosphatase 1B by casein kinase II and p60c-src in vitro.
9571630 1998 Characterization of protein interaction among subunits of protein kinase CKII in vivo and in vitro.
9525959 1998 Identification and partial characterization of factor Va heavy chain kinase from human platelets.
9461343 1997 Two putative protein kinase CK2 phosphorylation sites are important for Myf-5 activity.
9407077 1997 Properties and phosphorylation sites of baculovirus-expressed nuclear inhibitor of protein phosphatase-1 (NIPP-1).
9185604 1997 Phosphorylation of both phosphoacceptor sites in the HIV-1 Vpu cytoplasmic domain is essential for Vpu-mediated ER degradation of CD4.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
9092824 1997 Nucleolar protein B23 stimulates nuclear import of the HIV-1 Rev protein and NLS-conjugated albumin.
9074495 1997 The putative cell cycle gene, enhancer of rudimentary, encodes a highly conserved protein found in plants and animals.
9045708 1997 Phosphorylation of a vesicular monoamine transporter by casein kinase II.
8954982 1996 Casein kinase 2 phosphorylates recombinant human spermidine/spermine N1-acetyltransferase on both serine and threonine residues.
8806671 1996 Phosphorylation of HIV-1 Rev protein: implication of protein kinase CK2 and pro-directed kinases.
8663403 1996 Phosphorylation of the MADS-Box transcription factor MEF2C enhances its DNA binding activity.
8663267 1996 Phosphorylation of purified bovine bone sialoprotein and osteopontin by protein kinases.
8663258 1996 The physical association of casein kinase 2 with nucleolin.
8659106 1996 The human immunodeficiency virus type 1 Vpu protein tethered to the CD4 extracellular domain is localized to the plasma membrane and is biologically active in the secretory pathway of mammalian cells: implications for the mechanisms of Vpu function.
8639568 1996 Identification of insulin-stimulated phosphorylation sites on calmodulin.
8622969 1996 Human vitamin D receptor phosphorylation by casein kinase II at Ser-208 potentiates transcriptional activation.
8592152 1996 Casein kinase II phosphorylates the neural cell adhesion molecule L1.
8548340 1995 Functional analysis of the phosphorylation sites on the human immunodeficiency virus type 1 Vpu protein.
8547318 1995 Expression of recombinant elongation factor 1 beta from rabbit in Escherichia coli. Phosphorylation by casein kinase II.
8491187 1993 Multi-site phosphorylation of the protein tyrosine phosphatase, PTP1B: identification of cell cycle regulated and phorbol ester stimulated sites of phosphorylation.
8404858 1993 Multiple and cooperative phosphorylation events regulate the CREM activator function.
8288648 1994 Molecular mechanism of the synergistic phosphorylation of phosphatase inhibitor-2. Cloning, expression, and site-directed mutagenesis of inhibitor-2.
8253806 1993 L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6 and serine 12 in vivo and by casein kinase I.
8206911 1994 Isolation of phosphorylated calmodulin from rat liver and identification of the in vivo phosphorylation sites.
8188223 1994 Assignment of the human casein kinase II alpha' subunit gene (CSNK2A1) to chromosome 16p13.2-p13.3.
8139011 1994 Differential activities of the human immunodeficiency virus type 1-encoded Vpu protein are regulated by phosphorylation and occur in different cellular compartments.
8107101 1994 The human immunodeficiency virus type 1 encoded Vpu protein is phosphorylated by casein kinase-2 (CK-2) at positions Ser52 and Ser56 within a predicted alpha-helix-turn-alpha-helix-motif.
8089108 1994 The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases.
8058322 1994 In vitro phosphorylation of caveolin-rich membrane domains: identification of an associated serine kinase activity as a casein kinase II-like enzyme.
7983041 1994 Identification of phosphorylation sites unique to the B form of human progesterone receptor. In vitro phosphorylation by casein kinase II.
7896000 1995 Protein kinases. 4. Protein kinase CK2: an enzyme with multiple substrates and a puzzling regulation.
7794926 1995 Interaction between casein kinase II and the 90-kDa stress protein, HSP90.
7794916 1995 Interaction of nucleolar protein B23 with peptides related to nuclear localization signals.
7735329 1994 Activation of rDNA transcription by FGF-2: key role of protein kinase CKII.
7689229 1993 The 25-kDa FK506-binding protein is localized in the nucleus and associates with casein kinase II and nucleolin.
7678037 1993 Insulin regulates serine/threonine phosphorylation in activated human B lymphocytes.
7651819 1995 Activation of mammalian ribosomal gene transcription requires phosphorylation of the nucleolar transcription factor UBF.
7491787 1995 The human immunodeficiency virus type 1 Vpu protein: a potential regulator of proteolysis and protein transport in the mammalian secretory pathway.
3128543 1988 Identification of the phosphorylation sites of clathrin light chain LCb.
2998765 1985 Topoisomerase I phosphorylation in vitro and in rapidly growing Novikoff hepatoma cells.
2900140 1988 Analysis of sites phosphorylated on acetyl-CoA carboxylase in response to insulin in isolated adipocytes. Comparison with sites phosphorylated by casein kinase-2 and the calmodulin-dependent multiprotein kinase.
2874131 1986 Clathrin-coated vesicles contain two protein kinase activities. Phosphorylation of clathrin beta-light chain by casein kinase II.
2806554 1989 Identification of sites on chromosomal protein HMG-I phosphorylated by casein kinase II.
2663470 1989 Myc oncoproteins are phosphorylated by casein kinase II.
2557337 1989 Phosphorylation of DARPP-32, a dopamine- and cAMP-regulated phosphoprotein, by casein kinase II.
2174700 1990 Isolation and characterization of human cDNA clones encoding the alpha and the alpha' subunits of casein kinase II.
1985907 1991 Phosphorylation of cardiac and skeletal muscle calsequestrin isoforms by casein kinase II. Demonstration of a cluster of unique rapidly phosphorylated sites in cardiac calsequestrin.
1766873 1991 Mapping of the human casein kinase II catalytic subunit genes: two loci carrying the homologous sequences for the alpha subunit.
1740119 1992 Casein kinase II phosphorylation increases the rate of serum response factor-binding site exchange.
1541298 1992 Human-immunodeficiency-virus-type-1-encoded Vpu protein is phosphorylated by casein kinase II.
1520270 1992 Insulin-stimulated phosphorylation of calmodulin.
1516134 1992 Casein kinase II is a negative regulator of c-Jun DNA binding and AP-1 activity.
1425701 1992 Specific phosphorylation of the acidic central region of the N-myc protein by casein kinase II.