Property Summary

Ligand Count 100
NCBI Gene PubMed Count 174
PubMed Score 221.26
PubTator Score 26.07

Knowledge Summary

Patent (7,051)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Squamous Cell 110 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Disease Target Count
Squamous cell carcinoma 129
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.373 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.100 1.4e-03
intraductal papillary-mucinous carcinoma... -1.100 5.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.3e-02
ovarian cancer -1.700 9.6e-08
psoriasis 1.200 5.0e-03

 GWAS Trait (1)

Gene RIF (54)

AA Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKI      1 - 70
LKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYE     71 - 140
LLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMY    141 - 210
DYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRK    211 - 280
RWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR    281 - 350
//

Text Mined References (189)

PMID Year Title