Property Summary

Ligand Count 180
NCBI Gene PubMed Count 523
PubMed Score 377.73
PubTator Score 369.76

Knowledge Summary

Patent (14,378)

Expression

  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 3.5e-03
lung cancer 1.100 5.4e-03
medulloblastoma, large-cell 1.200 2.2e-05
non-small cell lung cancer 1.139 1.7e-17
osteosarcoma 1.567 5.9e-05
ovarian cancer 2.200 2.2e-05
Rheumatoid arthritis 1.600 1.8e-02
sonic hedgehog group medulloblastoma 1.100 5.3e-04

Protein-protein Interaction (1)

PDB (105)

Gene RIF (279)

AA Sequence

MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL      1 - 70
KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI     71 - 140
LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD    141 - 210
YSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKR    211 - 280
WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN    281 - 350
MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ                                 351 - 391
//

Text Mined References (534)

PMID Year Title