Property Summary

NCBI Gene PubMed Count 20
PubMed Score 2.51
PubTator Score 8.01

Knowledge Summary

Patent (1,779)

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.600 6.8e-03
psoriasis 1.100 4.1e-03
glioblastoma -1.200 5.3e-04
medulloblastoma, large-cell -1.500 3.1e-05
pancreatic ductal adenocarcinoma liver m... 1.002 1.9e-02
adult high grade glioma -1.300 5.4e-03
group 4 medulloblastoma -1.100 1.9e-02
ovarian cancer -1.200 7.5e-08

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (7)

PMID Text
19005213 These results indicate that CKIgamma2 hyperphosphorylates the serine-repeat motif of CERT, thereby inactivating CERT and down-regulating the synthesis of sphingomyelin.
18794808 Ligand-dependent ubiquitination of Smad3 is regulated by CK1g2, an inhibitor of TGF-beta signaling.
15917222 CK1epsilon and CK1gamma2 were found to bind to Per1 and to promote its degradation
15342122 Observational study of gene-disease association. (HuGE Navigator)
15300631 Data indicate that SNPs rs740423, rs2277737, rs1059684 of CSNK1G2 gene may contribute to familial febrile convulsions in children.
15300631 Observational study of gene-disease association. (HuGE Navigator)
15077195 MTA1s interacts with CKI-gamma2, which can phosphorylate MTA1s in an antiestrogen-dependent manner.Estrogen stimulates CKI-gamma2. CKI-gamma2 phosphorylates and modulates the functions of MTA1s.

AA Sequence

MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNE      1 - 70
YVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLK     71 - 140
TVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHK    141 - 210
SLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLC    211 - 280
ENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQ    281 - 350
LRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK         351 - 415
//

Text Mined References (26)

PMID Year Title
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19005213 2009 Casein kinase I{gamma}2 down-regulates trafficking of ceramide in the synthesis of sphingomyelin.
18794808 2008 Ligand-dependent ubiquitination of Smad3 is regulated by casein kinase 1 gamma 2, an inhibitor of TGF-beta signaling.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15917222 2005 SCFbeta-TRCP controls clock-dependent transcription via casein kinase 1-dependent degradation of the mammalian period-1 (Per1) protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342122 2004 Polymorphisms of casein kinase I gamma 2 gene associated with simple febrile seizures in Chinese Han population.
15300631 2004 [Five single nucleotide polymorphisms of casein kinase I gamma 2 gene in children with familial febrile convulsions].
15077195 2004 Metastatic tumor antigen 1 short form (MTA1s) associates with casein kinase I-gamma2, an estrogen-responsive kinase.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15003508 2004 Association of CPI-17 with protein kinase C and casein kinase I.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
9403068 1997 Cloning and chromosomal mapping of human casein kinase I gamma 2 (CSNK1G2).
9110174 1997 Large-scale concatenation cDNA sequencing.
9006905 1997 A casein kinase I activity is constitutively associated with Nck.
8619474 1996 A "double adaptor" method for improved shotgun library construction.