Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.22
PubTator Score 4.86

Knowledge Summary

Patent (1,485)

Expression

Protein-protein Interaction (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (4)

PMID Text
24442433 CK1gamma1 phosphorylates p65 and consequently promotes its degradation by ubiquitin E3 ligases CUL2 and COMMD1.
21680713 casein kinase 1 gamma 1 phosphorylates claspin
18773076 Casein kinase 1 gamma 1 reduces HIV-1 infectivity by affecting Gag processing
12119564 A 1756 bp cDNA encoded human protein kinase CK1 (438 AA, mol wt 50.272 Da, isoelectric point of 9.37) mapping to chromosome 15q22.

AA Sequence

MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYV      1 - 70
AIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKT     71 - 140
VLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKS    141 - 210
LTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCE    211 - 280
NFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAIT    281 - 350
RESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR    351 - 420
HK                                                                        421 - 422
//

Text Mined References (18)

PMID Year Title
26428916 2016 Gene expression profiling of DMU-212-induced apoptosis and anti-angiogenesis in vascular endothelial cells.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25416956 2014 A proteome-scale map of the human interactome network.
24463883 2014 Clinical whole-genome sequencing in severe early-onset epilepsy reveals new genes and improves molecular diagnosis.
24442433 2014 Casein kinase 1?1 inhibits the RIG-I/TLR signaling pathway through phosphorylating p65 and promoting its degradation.
21680713 2011 Role for casein kinase 1 in the phosphorylation of Claspin on critical residues necessary for the activation of Chk1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119564 2002 Molecular cloning, mapping and characterization of a human CK1gamma1 gene.
11124537 2000 Cloning, expression analysis and chromosome mapping of human casein kinase 1 gamma1 (CSNK1G1): identification of two types of cDNA encoding the kinase protein associated with heterologous carboxy-terminal sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.